MZ@ !L!This program cannot be run in DOS mode. $N> _n _n _n-_n->_n-_n _o^n-_n- _n- _nRich _nPELܝH  P10@P@00.text  `.rdata00@@.dataD0@.rsrcP@@VWjP3DP3D=3DV׃~S3DhjVV׃[_^VWj3蕕P3DP3DV3DL$ Q+uPWV3DGt_^VHhp4DP tT$N^Ë^́D@D3ĉ$@/1ycD$Wh>|$SUVj趔P3DP3DU33D^;ÉD$L$QjSD$TUD$,,D$0D$PD$T3DuiD$HPIu+T0wHD$H׋+ъ uD$HPu+|D$HPu+t;\$V\$;t6T$VSRJ`ST^][_$@3DËf́@D3ĉ$G.aSP`؃W;VWjh4DSn t{jh|4DSZ tgjhx4DSF tSf|4D ~4DfD$ ÈL$Ѝ$u|$ +ƒOuȃT$ RSÃPu+8L\J_^[$3́@D3ĉ$$$$U$VW$,tjU3D53D$Phj hU֍L$Qhj hU֍$Pu+D$Pu+fx4DDf z4D$Ju+ƃOuȃIHu p4D t4DHD$u+ƃJu>f4D=Df4DG$Аu+ƒOujU3Du+f |4D=Df~4DD$WЊu+ƒOujU3D$53DjhhhUDjhhhU֡DȍyIu+σL$ QT$Djh4DRuD$Pjj h Djh|4DQ u8T$RPj hUhU3DP3DjjhhU3DDjhx4DP u&u!L$QPj hU֋T$ Rjj hUָ$_^]38́ @D3ĉ$$hT$Ruf4D 4DfD$L$ {uf|4D ~4DfD$L$ Zfx4D z4DfD$L$ D$Hu p4Dt4DP$Pu+hDPL$Q$ 3B ́D@D3ĉ$@S$TUV$`W$\VjWVjSj3赍P3DP3DT$RL$LL$D$\UQPD$,,D$0D$T3DT$RT$D$LjD$ D$Ph4DPuL$VQW]) wjT$Lh|4DRP uxD$VPS FjL$Lhx4DQ u,|$u%T$VRWD$ VPSŋ$P_^][3D́<@D3ĉ$8$D-$LSUV$LWt*-t3"$XPQhDVAJ$X=-3Dt5 jj[Pj2E=3DjjhhV׋؃jShhVjjhhV;|!jjhhV׃PjFjjhhVׅ0jShhV- $@jjhhVՃt0ujQhP3DjjhhVՋ3~'T$@RWhhVՍD$@P!;|hDhDVH jV3Dn3DjjhhVӋLL$@QWhhVӍT$@Rh@VhlP3DjWhhV(L$@Qh@VhD$P-P3D=3DT$@RjhhVjjhhVjPhhV3DjjhhVӋphD$@PWhhVjWhhVӍL$@Qi3DjjhhVӋjjhhVӃ;T$@RWhhVjWhhVӃD$@PWhhVjWhhV$2EtjPj0hV3Dj趈P3DP3DS3D;ljD$~W-3DT$RjWL$LSD$$,D$(L$HD$LՃuD$@PjhhV3D;|$|hDhDVI $H_^][3A<@6@@@Z@jh`@PhP3D̡DV3;t PN5D5D^̡DS3ۅW=DUl$VGPgPOudwYB:utH:Nuu3u1Ŋ:utP:Quu3tǰ;Dq^]_[W}^]_[_[Ë̋ D U33;~zDV3;͉l$~eSWy$u+t:tJ;L$| ;s B*D$ƃ°;5D|_[^] _[^] ̃=D~mVt$ DiT uDVY uD$ +I uVX^39 D~#D$DiˆHHYH̡D̋D$D́@D3ĉ$=D=D蝌$ u$PD$Hu 4D4Df 4DP4DfHSP D$h4DP؃twW39=D~bV5DYSL$hQ? t@VRFQPVNQT$h4DRu ư W;=D|^S_[$3[̃@D3ĉD$ Vt$舋֍ uVjVD D$~PD$h4DP T$L$QRh4DVL$ ^3́@D3ĉ$$ hL$QP|3D~VW4Dt$ 3_^uD$3_W|$~BiVP3nDt"=D~VE;|^_Ë^_́@D3ĉ$=Dud$ u$PtD$Hu 4D4Df 4DP4DfHP $PV395D|'d$L$QVT$ R ;5D~ݍD$PhL$ QT$RhD$P$ ^3jh`"@Dx3D́ @D3ĉ$=DS=DT$ uD$P@D$ Hu 4D4Df 4DP4DfHP D$h4DP؃tvW39=D~ZV5DƪƍPu+t(ZVQRVFP^Qh4DSVư;=D|^S>_T$RhTD$PL$Qh;T$R$$[3o S3(Ph3Dtll3Dt\W|$ ǍPu+VPjB0Dt2V0Dt'Ћ+׊ uV|0DVjp3D^_t3D[̋D$@̋L$y Au +AA3̋T$JB UV2W39zl~i SI;sY:u8Bu Z! u 8Bt8Bu BB9z+J[_2^J]ÿ[+J_2^J]̋D$3@HHH"H#H$Vt$N$ɋF t PjVу N"t~|N ~uV!+F F3^QUl$ }EVuW} L8D$ L$Sd$;|$<:uV}|PVRWt=FPFt,NQVRÈE E}+} D$[}_u^]YD$[+} D$ }_u^]YQS\$ {CVs L0W;D$ L$U;t${|4%PL$Ƌ,^[#D$ G#_ÊL$D$O#[_̊T$W|$€T$ uD$th_S_#tLVPFȋD$΋^uL$t[O#_[G#_ÀD$tW#[_W|$u,D$ t}ȋD$ʀɀ_S_#tCT$VL$Ƌʀ ,^[#D$ G#_ÊL$D$[O#_ËD$_W|$u9L$ ɋD$9Wt(IW_À#taSVt$t$BG_#T$CȊ*,#D$G#^[_ÊL$ D$O#_̋L$3Vt$W<+ƃPjVh H$u HBtɺ3҅$u H@tɺ3҅(u HItɺ3҅tc+ȃQjP jUl$tX;sZSb؋;.|3+Rj V t;r[]_^_^[]_3^[]_^]_3^Ë]_^QSUVW|$w O/339_T1G$p-@T$I;t$EybO":uG"zVuPW _"cSWMG"P_"'VSWG" :t_"EG9_Y+w /w_^][Yø+w /w_^][YQSUVW|$w O/339_T1G$-@T$I;t$G;}u2G":t_"VSWnMG L8 GGuGG":t_"E$hPȞL$hQ$R$P6P_4 j5Pj*PjPjP5PE5$3d ́ @D3ĉ$$hP$ hQ<3$ IDu3 $I"DuVWjcjWj Ij ; ǣD?XDe\D{D!PhD/./$_^3^ ̡D̡D̋ D; Du3̡Dt;DtPXODP]=Dt)P:O DQ>=y6h 6Dz DD.n)t̃DD>6 nh6D*Y3=Dt̃ @D3ĉD$D$$SUl$0;VD$ h6DW˧t~kh6D赇h6D舊Vh6D}Vt)uO[:uF,u hkEjWU>uhkEPWU>t h07DB_^][VhkEjPQa>thh7D^́@D3ĉ$=0D$U$VW|$ L$NՉD$D$ D$ ;2hkEjT$RU=;fD$h8D@BED$Pu+Sظ(CEPu+ˆ\$!3$BET "΄u(CEt#D"+uLD$|$ [u!hkEjD$PU =u|$tuh7D谂_^3]$3ڪĸh7Di_^]$3質ĸh7Db_^3]$3茪ĸË$_^]3̸oĸ́0@D3ĉ$,V$<W30Duvu0$<D$>_^$,30Ãu<tu2$<WD$ >_^$,3©0Ë$4_^3詩0́@D3ĉ$SU$V$W$3u0DDE+֊ u3DDDD$PAVfDfD&Dtu =|CEtuhDh<9D蚀Uh$QVutKP @ RQhD D R谢 DPQ蚢PhDWh9D9mttVh8DDRESPhD DQ;СDRP&PWh8DtB DDD|$L$ DT$D$ L$$IDfDD$8D$4D$5fT$63BEL<uBEPu+x - DDEQRPD$ 3hxBEDDDD?Du;Uh$QhxBEt P @ RQhDA ,DRfDfDPҠ DPQ輠Ph8Da~DD DT$$D D$L$ T$$jjj,t UjD$ PVtuoϋō|$4D$uD$u |$ZL$Qh8D}Ve2 hxBEh`8D}tuZUVu V"2ϋō$D$)euVD$,u|$)t T$)Rgt,hP8Dh@8D}V1 h$8D|Ƌ$_^][3'ČÁ@D3ĉ$U$VW3u=0Djjjr h:DdUjhDV&sfD DfD$FD$DD$EL$H3$BELLuBEP$u+H ō|$DD$uD$u|$ZtT$Rh8D{V~0 |$u DD$D$L$h9Do~jWL$(QVfD$2fD$0D$4ԝT$ RD$(PV|$豝t\jVru@$L$ QT$8RP|$肝urPh9D7D$8L$&WRPh9DEPh9D 8Ph9DU7Vp h9Dzuh9D}}UjhDV?qUV|u$V/_^]$3蘢Ġ DDEQRPD$ȃ ō$D$uVD$@u|$tL$Qh8DyV. |$u DT$D$L$ Ph9D:6sD$ L$ tfQ RPQHRPQ$RPh|9DhkEjQc>ȸQƒ(thX9D>yVho$_^]3_Ġ̸(0F@D3ĉ$$0$80S#0DUT$$40V$@0؉T$$<0WL$T$, EkEt$|~ tu 5,DxBEȍyu+hkEh 6DVP $$4PhkEh$@QU;ȸQƒ;tƃXjT$RhhUt$$Lu0Ph<;DM4jD$PjhUt$$uPh<;D4jL$,QhhUft$ZuřPh<;D3;޸tU;tQtL |$8DWRh(CEhBEh,;DhkED$LPU <ȸQ yhBEh$;DhkEL$@QU;ȸQƒu@4DRh(CE|$$hDThPDhDhVD$Qh"DT$ hDRY$VDPIu+u7IVDu3$VDuSVWjhDpDhDlD$$\DRlD hD"XDP觉 DQ+{DlD PDRjPQhDhDVDDg,_^DD[3 $ID kEuTjRjjjh"D:hkEjpj{$Pu+t4$R褱$3ĴjR}{$3Ĵ́ @D3ĉ$ V$ =Dth\;Dbm!D$ PL$hQT$R$P$ Q$RV  SD$ Pu+u26D 6Df6DD$ L$fT$3DL`uhDj}3Du3$L VDu3L`Du3$ "DuSWhDpDhDlDqD$$( $0 jPD XD`D\DmXDP DQv$@ _[tP耆XzxDlD PDRjPQhDhDVDDDD3 $ID kEu8QjOjjjh"D7hkEjgx$Pu+t&$RԮ^$ 3B P^$ 3' j)Ox$ ^3 ́ @D3ĉ$ $ D$PQy=Dth\;D\jT$hDR D DDhDPQR:xj\DPl XDQDRtD$PL$ Q DT$RD$$PQ4T$(D$0L$$RT$0PQRzhkEjh$ PB@xv DlDPDQjRPhDhDVDDVDD3 $ID kEuNjqMMDhID>Rjjjh"D5hkEjGe v$ 3Ĵ jM{v$ 3Ĵ hH;Dh$ 3ːĴ jL$ 3謐Ĵ ́@D3ĉ$Wh|;D3?hGut PZ^D lDPDPjQRhDhDVDDt)D$hP?|jjL$jQ4 jLvu$_3̡D;DuVDD^̡D9Dt P}]VDD D D^́@D3ĉ$$PD$0DD$u|$ w$3ĘÃu@h;D0DLEt,h;DP0DPEu LEQ0DLE$3迎Ę̡LEtP0DLEf;D ;Df$ED$( &Ex:jPh$E*PE f&E\tzT$RL$$QT$Rh$EЅt?D$L$j h$EPQh$Eyh$E$8 $E(à;Df;D&Ef$E$E(ÍL$QT$RD$PL$8Qh$E0Du;T$,$T$҉T$ h$ED$};D$踈 $E(f;D ;Df$E &E$E(̋D$L$ ÃSUl$(MxVW|$4G+;t$8}tt tʉO+G WM|+;}tt tʉO +GG+t$,93DEl$4L$QPVPT3DT$+D$+L$WQVT$D$X3DD$4T$RQVP\3DT$$L$D$jRT$(RQPD$,D$HL$0QVP`3DD$4D$4nW +W9E(D$4L$QPVPT3DG +T$+GL$D$QVT$D$X3DD$4T$RQVP\3DT$$L$D$jRT$(RQPD$,D$HL$0QVP`3DD$4D$4mW+9uG +G9EPD$4L$QPVPT3DW+O +D$+++L$T$ +OT$L$$D$D$PVT$X3DT$$L$D$jRT$(RQPD$,D$HL$0QVP`3DD$4D$4jW+jG +GjVd3D_^][̃ST3DUVW|$$D$PWӋt$(L$l$D$T$++‰N|L$,FxtIIjT$RVWD$(L$,D$PWӋD$jQL$RPQW`3D_^][̡E̡E̋D$-Vut$$PV<3D|$,dt 3^jjjjD$P@3Dt/L$QD3DT$RH3DjjdjdVL3D^uPV3D^D$(u PD$$P3DL$ jjjdQL3D̋L$0$PQuD$@t 030́@D3ĉ$SU$VW33ۃuO9$ ~ALhD$PjQjj0DD$Pffu+;$ |G|$9$ ~TR0D;$ ||WjB0D3;ÉD$u3P0DXXX pxuq$ LhD$PjQjj0DD$׋+f fuD$PIffu+;ލ|G|6$ 3~)$TRW0DDP0D;||ދt$V|0DƋ$_^][3迆̃ SVW=83D3 ED$ PVhQ\$׃u T$D~3 ED$ PVhQ\$׃u T$D~_^[ VWj=D503DPt7փPjg=43DPjgPփPjVP_^փPj3=43DPj3PփPj%P_^̃j&ojD$ o|$<$ujojD$ n$D$xU(VD$Dt$W|$SD$t uT$(URD"D$LL$$;Al$HD$L6[_hP观L$ +$uT$4L$8T$(L$,T$0 L$$IL$<+uT$@ET$ ;uHB^]ËL$HHHB^]̋W39~~/SIHPԀ;~|[F_É~>_ÃL@D3ĉD$HD$`S\$TU-83DW\$4D$D$PVWa |$||$r l$D$\$jVW uD$_^]SVt$ W=`2DjjjV׋\$hSjVSsVd2D_^[́ @D3ĉ$SU$VWى|$WSU3~ tTUoj jUo[u2j;U~tōPu+j)U+[t |$WD$hP,~ L$QDoj jUjoD$$Pu+;~LD$Pu++؍D$Ȋu+Ouȃj)U諀S$_^][3w S3Ul$ #Vqu+΀|:Wkt@F u> t~0j Vgyts< ut F< t3ЅtP|$t+j V,yt+WVSYq _^]ËӋ+֍I u_^]_^]Ul$ffEu^]jht'VF~f=fErf=v^fE]f^]̋U3Pu+ƒ<PKzF<Q,zFtu_3fE^f]jhtV`h;t>tNT$ +֊ uD$ j;PsstL$ QS>ct*j;VNsu_^$3jĜË$_^3̸jĜËD$-Vt3^D$ rtQtPD$ P3D^t$h@Dhj hV3DjV3D^jj?&Pje2E^=uPL$jQf@D*3D^t$W=3DjhhhVh@Djj hV_^UVW{W3ht+WUVakD$SPV%jVxVg _^]_^]́@D3ĉ$UV5|E33$jhhED$hPKjh_^[$`3 f]ÃVhq@WhP3D;3 $ID`u썄$`Pj95D2Et$`Q'y9t$D$ghT$\RVSL$ D$hPQT$pRVSD$PN$=D2Eu'$`PL$\Q]t$=D2ET$XjR覸D$,9Eu D$,9EuDD$PPVST$L$TQWRD$HPL$TQ0D~ D$,_|$,tX=Eu=T$PRVSpL$D$TPWQ`T$HRD$TP0D} D$,|$,t |$ut$T$L$ QVh+RD$0t$4D$@D$883D;t$et$\$=83DD$,D$0D$ PVh+SD$0t$4D$8jVhS_^[$`3|c]St$0.D$,9t$~FVSat.L$ QVh+WD$0t$4D$@D$883D;t$|$l_^[3c]́0@D3ĉ$,S$8UVW3$Pb0WL$QfD$0D蝞PWVRjRaL$<\$4QjuD$ j/PZ]Mj3\$d3ÃHu @=DfD=D F=DfPT$aRHQL$<j\$hG|$`*th3RfD$fD$fD$ fD$"`PfD$D$kP`L$rQfD$"`WT$RfD$0D^PWQ\$$jRVHj/VD$,Y j\$dL$4j(PQQjR%`fD$0D${P`fD$63fD$8fD$:PQ_P$RfD$<_fD$>$P_0WL$QfD$0DaPWPj\R_L$<Qj3@D$uP6PL$P\$<juWT$`D$ Rh<=DXtD$ t$$ƍPu+t6hVb$dD$ _^][3OXË\$$j3D$ j\$dnP^jhRP5wL$,Qj>L$QT$RD$jD$(P\$.D$tYWL$3Qft$$ft$&0DٚPWN\$,V3j.SD$4TWjh4=DPt t$ j\$dD$,|R]L$4QD$( j\$dQP]PL$oQfD$ p]T$vRfD$&a]t$uT$ R譲t$ 謹D$0D$,D$ Pjh+~P83D$_^[3<]́ @D3ĉ$ $ S`2DU$ V$ WjjjVD$$hUjVD$ U639|$ $Ih$QWVӍ$R0D$PƄ$]4$X uL$3Q$R$t$x0DtP0DD$,L$0$l$pT$R$\&;|$F$ Ph0DU0D39|${h$QWVӍ$R0DtO$PƄ$]3$X ul$U$\$\UQ ;|$|$ R0DVd2D$ _^][3:Ĥ ́@D3ĉ$U$$VD$6u D$ u D$# u D$ u D$"y u D$$g u D$(U u D$)C SWj3\$(GD$ Pu+ƒD$$PhX=DAj\$(ÍPu+ƒ t4D$$PIu+ƒ vSD$-t#jAu D$j\$(jD$$<tcj\$(uIj3u6P2ۍt$(t#RA ;D$Nj\$(SusDugj6uVD$$<luduluZD$PW$pQ$x $x $ RSVݢ؃ F][$h _^3 d ËT$RW$pP$xQ́T @D3ĉ$P W39=|E|$SUVD$PL$QWjj|$$$phR D$TPh0D0DPh=DjL$@j Q;(jT$LRD$phPhCL$xQDKt$8(;ted$jT$XR$`hPCjhD0DD$ PQӍT$RD$$P0DL$T$D$QL$RT$PD$QL$ RPQT$Dh>DRw$>Dt>D>Dt>DVT$,RQPhh>DH]D$ PQӍT$RD$$P0DL$T$D$QL$RT$PD$QL$ RPQT$Dh>DR$>Dt>D>Dt>DWT$,RQPhP>DNH]h@>D3L$|_^[3]Vt$It Hu^ËD$HS\$PSQ UW-hUU ƍu+ƃOuj\ȃj/UC,>DSf>DT$(fC >DRSK M_][^̃=LHEuj;Pt̋D$-Vt3^D$ Dt#tR#PD$ P3D^j j]Pj2E^=NEt$jh=DVq E -Qhj hMV$ E3DjV3D^T$t$W=3DjhhhMVEסE-Pjj hMVסE0A_tD | @wjhJV3DP3D $ Ejh=DQV^Vt$It Hu^ËD$HS\$PSQ UWk,hUU Ɗu+ƃOuj/ȃj\UGƃ->DSf>DT$(fC >DRSK IK_][^̋D$-t3D$ ~t7tPD$P3DL$jQ3D=Euj jPj2Ej jPjs2E=uT$jR3DD$Ẽ\@D3ĉD$XUV3W;l$ l$jwh?DV:  jh?DV"  jh?DV  tpjh?DV  t\jh?DV  tCjh?DV  t/jh?DV  tjh?DV  uD$ D$ h6D$tPD$h?DP: L$ht?DQ&53DT$Rjj hSօtUD$hX?DP L$h8?DQT$Rjj hS֋D$ tPD$h?DP L$h>DQT$Rjj hS֋L$d_^]3\̃|$SV@DuCEV3E~RD$ WP8t/VWt&ƍPu+8\tu_^[_^[^[SUVP(EE2=(EEt[WVSY΃yu+σLu8u$pIu+8Ttu_^][Q _^][^][ËD$-Vt3^D$ Dt#tRPD$ P3D^j j}Pj 2E^=NEt$jh>DV  E ,Qhj hOV E3DjV3D^T$t$W=3DjhhhOVEסE,Pjj hOVסE0A_tD | @wjhV3DP3D Ejh>DQV@ ^̋D$-Vtdt3^D$t!-ZD$jP3D^t$hEhj hZV3DjV3D^=Et$uh @Dh?Djj V83DW=3DjhhhZVhEjj hZVhEjj hYV_^̋D$-tvt3D$ $@D$jP3DL$jQ3DT$jR3DD$jP3D=EVt$uh8@Dh(@Djj V83DhEjj hV3D^@<@'@@̸hf@D3ĉ$d= D$\hPY$thL$QRjІ= Du)D$PhpAuzPhP3D+&VWhkEL$ QjjjD$yt$3P<t(E+I uEEPu+j$hR$p hP'jhu4Sjj$jQ}hkEj|$ ^3E ́@D3ĉ$ V$@Dt@DjL$QT$hRPD$ 躲Puhj} ulD$ Pu+tXuD$ P6u1_jjL$jQ}hkEj$^3T́@D3ĉ$$ $PQ膃T$R\ T$3W=3DtjjhhVtjjhhVtjjhhV@tjjhhV tjjhhVtjjhhVtjjhhVtjjhhVtjjhhV_SW=3D3SShhV׃ujjhhV׃ujjhhV׃ujjhhV׃u@jjhhV׃u jjhhV׃ujjhhV׃ujjhhV׃ujjhhV׃u _[̃`@D3ĉD$\V3DTq;^hkED$PjjjD$kjQL$ jQD$ tjPPT$RU $PyjL$QjQT$Rj1Phu D$PtL$\31`̋D$-Vtvt3^D$tD$jP3D^t$jjhhV3DujV3D^jV3D^3Do;u"L$hADjj hQ3D^T$h@Djj hR3D^́@D3ĉ$$-V$t:t3^$3$wfjV3D[W3D.o;=3DuhHADh0ADjj hkVED$P$ L$Qjj hjV_$^3̸m̋D$jh APh:P3DS\$Vj]St]j/Vtj/P.uNWxu+ǃPQV jSqx._uf]^[́@D3ĉ$VW$WT$ uWLW6D$Њu+ƒOuȃ󤋌$ _^35̃|$Vt$uj;V#tIj.V#t:HDPuJIu JRtɺ3҅u^QWj:Vuij*VuZj?VuKjVdu-j|VUuj"VFuj\V7t-jD$PhVjPhR^_YË_ÝD@D3ĉ$@VW3@D9=DD$P-Q0DP0DT$(D$$RP=E@DuBj~Vh@0PjHP3DuG_^$@3:Dá$ Eu:HVL$ Q0D3҅_^‹$@3DËNj$H_^3D́@D3ĉ$ $$ SU$VWl$t+t33$,QPhDUKg$, mtPt*hDhDUf jU3DhDhDUf jU3Dj j9Pj2E-PPhhU-3DՋRQD$WVhhPՋxB2D EQR 4uL$jPhhQjӃyWE \$QQhhU3Dj83;E`jwh?DV\$  jh?DV jh?DV uG,Ph|ADL$Qjh?DV uW,RhpADD$Pjh?DV] t]jh?DVI tIjh?DV5 u-Qh|ADCjh?DV u<-PhpADL$Q!-RhdADD$PO,QhdADT$R D$P:u+tD$PShhU3Dh; E hDhDU)g jhU3DP3D$_^][3:S3V@D9DWjPN,Q5P,{ ;=E@ Du2j׬Vh@艥Ph螥P3DuC_^[á EuHVW0D3Ʌ_^[_^[^[Á@D3ĉ$ VW3Df;u3k;ShkED$P3SSW\$ D$ ;ËU-3D<tE+֋ ujh@=E肤Pjn蚤PՃteuREPIu+t83ELuu L$QV蠝 T$RV3HP]D$ P2y[uuphkEj2$_^3̃ @D3ĉD$D$-L$Vt$t3^L$3 D$ \t?tPV3DEPjj hV3DjV3Djj蝪Pj,2E wx$IhP$QQ$UjR؋ŃȊu$I+IOuȃ=EEu Stj\$Mj/P~  ADfADL$ L$fT$$D$HADQT$ RD$.k^V:H;$8uV;H;u<D$HhPL$PQ1Ń Ȋu|$H+Ouj/ȍT$Lj\RjADf ADD$,fL$0PT$XR$`$h $l$x$|$L$(QT$4R$DŽ$H$ _^t5D$ PhP@蜏Ph豏P3DtL$ Q+A'u;ADfAD ADT$T$@hRfD$$L$&D$P4) L$ Q)&u/ADADL$@hQT$ D$$HT$R( ADf ADADD$D$PfL$ T$"(L$QcT$ RcN[$ ]3Ą ̸@D3ĉ$VҬ;SO$hkED$PQ3VS\$( T$RSh 6D\$P#D$$t$ 5E;Ët$ UWt$D$LhP-L$TQcT$XSR9$ 8t|E+I :uSh@E胍Ph蘍P3DGEА:u|$L+ƒO:uȃPƋ֊:u|$L+ƒO:uȡhBEuU u Uj/D$Pj\P \$fD$L'$I:u|$L+ƒO:uȃ|$LG:uf ADfI:u|$L+O:uȃ|$LG:ufADf|$LG:ufADf#uT$L+Պ :uL$:9\$t T$R`$hP\$SSL$\SQ5{uQhkEhh 6Dh 6DDquT$RSh 6DhgSS$SPz|$uT#uJ ADfADAD$$hQf$$A$R$ AD ADT$ D$$L$($MRz<~$MhP$UQl$ Ń :u$M+ƃO:uj\ȍ$Qj/RWBDf BDD$0fL$4P$]R$d$l$p$|D$L$l$p証$t̽$xD$L$ $|tl|$uTg!uJADfAD AD$$hRf$$$PK# L$ Q\$:#T$H;ÉD$19\$_]u9 u/AD ADT$DhRD$$L$(=D$ P" 9\$[t L$Q]T$R]ADf ADADD$D$PfL$$T$&"<$^3̸@D3ĉ$V¦;;S?$D$P$Q3R\$O D$PSh 6D\$PD$ ;Ét$ 5ED$UWIL$LhQ!T$TRWD$XSP|D$0Ȑ:u|$L+O:uȡhBEuU_ u U j/L$Pj\Qf fD$L'Ѝ$:u|$L+ƒO:uȃ|$LG:ufADfI:u|$L+O:uȃ|$LG:ufADf|$LIG:uf ADfuT$L+Պ :ul$:9\$t T$Rj[$hP\$qSSL$\SQuuQhkEhh 6Dh 6DkuT$RSh 6DhSS$ SPcu |$uTuJ ADfADAD$$hQf$$$Rc AD ADT$ D$$L$($MR~<3M:u덄$MPŃ$:u$M+ƃO:uȃj\󤍌$Qj/QBDf BDT$0fD$4xP$]Qz$d$l$p$|$D$L$p#$tG$xD$L$ 3$|tl|$uTuJ ADfADAD$$hQf$$#$R D$ P\$H;ÉD$9\$_]u:cu0 ADADD$DhPL$$T$(軺L$ Qa 9\$[t T$R}XD$ PpX ADfADADL$L$QfT$$D$&躳$^3+́ @D3ĉ$ UF;>Sò39$ \$ UUh@襂Ph躂P3D;ʼn$ t hkED$PUUS\$$YhkEL$ QUUU\$0CD$8(;tH;uD$VW|$;t(UWH;uދD$;Ë-0DSV$+֊ :uj/$j\REE :PD$P$QV ;c8WF$ 85WgH;&d$8uWB;H;uT$PR$P6V ;L$8QRՍD$,PQEuhT$RD$AD$jP3DL$jQ3DT$jR3DD$jPL E3DD$8Vt$< Eu"h8@Djj V83D < EQ-Rh(@Djj V83D< EH,Qjj hV3D^I>AP>A;>A&>AQP EP$u+uL$D$ PQhP E2DYVW|$ j,hCDW3 t8jhCDWӱ t$hCDWuhCDWtZǍPd$u+ƒDP蹰t,WhHCDVH jh4CDV'fP2DV誯_^_^Vt$4, EjP0DhhEVuGjh?DV tjh?DV udEjjheP3D , EQ0D^̡, EVjP0D hEu t$5hE6hht $Ihhut$ht^S3DWBj~h?DW1 tjh?DW udEjjhdPӋhu_[ , EQ0D^́t@D3ĉ$p, ESUjP30DhEtKVWADs3ut UhhSޅu_^jjh-hEdEdP3D, EP0D ADfADADL$ L$QfT$D$$|][3t̸L(ֽ@D3ĉ$H($X(SU$\(WD$ D$ $$\(jL$QhhR輨tD$+D$3-WdD$ D$$D$(0D؃t-t(jh4CDh0DDbP2Du SW1DjhUD$(PjhW1D؃u jjjS0D`t+jF`jhjQ@ ED EL3DT$(RXl$dD$0 $=XEL$ Q$`(T$Rjh$`(PQ}T$P($PT$(l$,D$4D$8Tu L$(Q T$(RL$@jD$PQ$\RS0Du dždu0dt%jD$PU$\(QS0Du dždř@D`t0 E4 ED@RP赂h;u=XEdF9|$u(h DDh DDŃ`t =L Eudu dždTtIT$($PRL$8D$<L$@jD$PQ$\RS0Du džd`t=WP2D`VWjۭ +@ ED Eǃ@ ED E jj见9=Du"HHu Lt PPPS0DS0Du8!PhDD>?#WhCDWhCD蓂džd$\(jWt֤PhCD>W 7=XEuKdtBt=|$ WjjhCDPjEWjjhCDQXEhCDWjRG8|$ D$PPWh$\(QREduhCDhCD|$P(PduNj$T(_][3ɩL(Vu^jeD$L$ Ph3AVQ^P3D^́4@D3ĉ$0$8dž@džD$@$<jD$PQR裰PhlDDWD$DPQEȸQƒ$}C`t$<$@@D$03踨4Ë`jh@4APh]P3D;tu L Ed$03j4̸h(V@D3ĉ$d(SUVD$jD$PhhS^tD$+D$3PPjL$,Qjh-VdD$< D$@D$D1Dl$d39`T$RU 1DPD$P8@<D @VL$QRUD$ 0DV50 E54 EԩVh@ E`jPD EL3DL$DQ-XD$0PT$TI9d\$=XEjL$Qh$x(RU1D!L$ 9lBED$u90Au0Q$p(jP D$tȍ$l(+ʉL$ L$ TL$H$l($lD$DL$PD$TTu T$DR D$DPl0QL$\$pRt$4Xtl$D$ 3@D9`t 0 E 4 ELbuXE|$u d=XEdTtJL$D$lQD$TD$X0L$\R$tPt$8 u LJdT$,$lRL$8D$<dD$@h\EjP$|QS @u LJd`t>jP2D`WjXjK +@ ED E@ ED EU0DdLJd0P$p(Rt$4LJdpVhtDD,VhtDD|LJdjS|t[PhCDx8T$lRh\Eh$x(PQ?|$l(RduƋ$p(^][3ˣh(̃=XEQl$ƒSW`t:=@ ED E t(D@SWRPRPSWhED{ hDD{9dt$`-Qhau=L E_[Ã`t;=@ ED E t)D@SWPQaRPSWhDDz_[_[D$DD~z̋D$ =VWZ-tU+PD$4t#- t+7=L E_^ =L E8 Ed=\E_3^ t$,=T3DSL$ QV׋T$ D$)T$)D$L$QVP׋T$(D$ L$‹|$+‹؋+‹T$jQL$,+؍ +‹ȋǙW+S+QV`3DjV2Djh`P2D[_3^ 9|$4ua9=pEt$,uV2DWVpE2D8 ERjjhWVL3D_3^ =u D$88 E_3^ ̃u?9 DtEt.` $T$uU $Qh=APjoUP3DÃuă=Dú@D3ĉ$=XEQ$ ƒSW$F,T$+I uj~hTFDWU tcjhLFDWA tO`t:=@ ED E t(D@SWRP{RPSWhFDw@hFDw1hEDw EDEDEDL$ EDT$D$L$d`T$Rh_L E[$3aj~hTFDWY jhLFDWA tm`tO=@ ED E t=D@SWQR{RPSWhEDv_[$3ڞËD@PQhlEDD@RPh8EDfv _[$3蓞́(@D3ĉ$$SVWh\EPD$2؃D@\QRPL$ d |$N,QuVRhFDD$4PhFDhFDT$4RӥD$(Ph6Dh\E$4QR:QƒL$ QSFT$RD$PSD$m jSD$贗t蓗PhFD1S)|$ u'hFDcPhFD1+L$Q2ЋD$RPL$PQhFDwL$ tRT$ RO)D$6$(Ph|FDtS,) h\FDxW$4_^[3脜(́(@D3ĉ$$SVWhTGDh\ED$0PQ9QƒD$(ejL$QT$Rl *D$ h\Eh hEjh?DQ蝍 uV5hEU3ɺ@HDhED$3@;ʼnD$t hE-Rl$;hEjh?DP+ uV5hEU3ɺ0HD2hED$3;ʼnD$t w hE-Ql$:YhEAD3l;us5hE,θxE:u:tP:Qu:u3;t:VhADSs+ȸQƒ tL$QΓ-L EhE,xE+Ѝ :uAD3uru5hE,θxEI:u:tP:Qu:u3;tVhADS* hE,xE+Њ :uAD3ul$ 9XE , EjQ0D9-L EunlhEjh?DR5 thEjh?DP u)-dESSh?P3DhEhP hE3, ERL E0D8G;q, EjP0D , EQ0DL\$0D9lEueD$;t]PP3D9l$ \$uLUjFGu29l$uSSh ?P3D9l$uSSh>P3D\$\$F9l$ Sh؜h>P3D$,_^][33Չ QV51Djjjjjj, E֣H ED$Pjjh]AjjL EXE`E贼3Ƀ( E^Y̡E̋ D+L$W=E;~Zɡ|E~Ћ uu |E ǂ t$Vd$ PDu=E^_VWq-+$7uq~xQ+7u=Du+7uƀ +7uqD+7uJ+7u#+7uL +7uuH +7uxL P T X \ ` d h l p t x |       _+^ uVt$ WV D$~-+uHQ~~+u=Du+uƆ +uDq+uJ+u#+u L+uH u+uL xP T X \ ` d h l p t x |       _+^ uøv@D3ĉ$V$D$PƍL$$^39́@D3ĉ$U$j8P3DP3DD$uVVhP3D }USWFPL$hHDQ譋#USWu hHDT$R h|HDD$P舋`DD$L$QRjP3D$]3{ĈVj88P3DP3DV3D~S3DWxhjVӃu_[^̋|ES339E~>Ul$VWL$9 `Du ;E|_^][̋L$`DT$jYD;E~:h 輁t)EVt$W |E_ |E^VW=|E395E~-SP_Q ;5E|[_^́ @D3ĉ$ $ $ $ $Q$ $ 3襁Ĥ S\$Vt$W|$uWjhS$3DP3DD$ EWPVSQ3D_^[̋3u tËt9u uË̋3td$u̡l)EV3;td$;u^Vl)E~d$Y^Ël)EW=h)E~#V"2o Ƌʉ$u^_3|'; h)E}D$hPP苏 Vt$t7Wt PVQ~-h)Eu_^̋L$3|'; h)E}hPD$P ̋L$3; h)EVWL$##+7uxx||_^̋L$3|,; h)E}$D$ T$PR# P ̋L$3|; h)E} # ̋L$3|G; h)E}?VL$ q+uL$J+^ űL$3|.; h)E}&Vt$ "+Ί1u^̡l)EU-h)EW3~WSVT$p:utZ:^uu3҃t;|^[_]^[_]_]̋L$3|9; h)E}1D$T$ Vt$   t$I^̋D$T$ T$  T$̉ L$%̡d)E̋D$d)E̋D$3SVH2Eq+t$ WPP-P~ |$:uJf# HD# ID'f IDf+ ID- HDL HD_^Puǀx|ǀ ǀ[̃|; h)E}ź @D3ĉ$$NV$W-L$ -tzt:D$ hPfL$ Qjj hV3Dhh EV} h Ejj hV3Dh=3DSjjhhV׃uDh6Djj hV׋3DjhVP03DPjhVP43DhDBh 6Djj hV׋3DjhVP03D PjhVP43Dh 6Djj hV[=3Djj(hhVjjPhhVjjPhhVjjPhhVjhhhVjhhhVhEjj hVhEjj hVhEjj hVhgEjj hVh Ejj hVhEjj hV׋(EjRhhVj8(EPhhV4uPhV3DP3D$$A=3W=6b=3DhEj)j hVhEjQj hVhEohEjQj hVhgEjQj hVh Ehj hVhEhj hVjjhhVjjhhV(Eף8(EEPu+u1EPu+tj)jhEoyj(hEhEGEPu+t:EPd$u+u!jQPhE&yjPhEhEwEjj=3Pjr2E3$_^3v ̃@D3ĉD$D$ NVt$ W--tS.f|$,Eu)jD$ hhIDPf~ L$Qjj h6V3D_^L$3[v=3DSjjhh6V׋(ERD$hhIDP~ L$ Qjj h6VjjPhhbVhEjj hbV׋((EjRhhVס,(EjPhh%V׋ D(EjQhhV׻uT$ hdIDRy}% u ShPIDD$P ShDIDL$QR} T$ RjhChUV׃ ~<(Ej PhNhUVh8IDjhCh~Vh,IDjhCh~VhIDjhCh~VhIDjhCh~VhIDjhCh~V׋ P(EjQhNh~VjhhhcVh 'Ejj hcV[_^L$3tT$0B=3=6=3DjjhhVjjhh%V((EjjhhV,(EףD(ED$Pjj h6V׍L$Q>hEjQj hbV(EjjhGhUVjjhGh~ V<(Eh 'Ehj hcVP(E_E3^L$3sjj/PjMo2EL$_^33bs̋D$NVW-tnrD$ wL|A$hAjh#T$ jhRD$ jhP jhL$Q3DP3D_^(Et$ jhHDRVv(E=3DjPhhV׋ (EjhHDQVv$(EjRhhV_^D$@=3t|=6t$ jhHDVv=3D jjhhV(EjhHDV(Ev jjhhV (E_$(EE3^jj .Pjm2E_3^ ~A~A1~A#~AJ~A̋D$NSVW-VD$-t$=3D3DU-3Dtty]_^[jjhhVՅu>=3DPhV׋3DPjhVPjhVP]_^[jhVPjhVPjjhhVՅuPjhVP]_^[T(Et$=3DjPhhV׋ X(EjQhhV׋\(EjRhhV*=3D3Du jhVP׃=X(Et u jhVP׃=T(Et u'jhVPjhVPjhVPh`(EhV腺 _^[D$@=3t}=6t$=3DjjhhVjjhhVT(EjjhhVX(Eh`(Ehj hV\(E_^E3[jjc+Pjj2E_^3[̋D$NSVW-3D$ t A$AL$hHDjj hCQ3D_^[T$hHDjj hhR3D_^[t$jjhhV3DujjhV3DP3D_^[t$jjhGhiV3D=3Du$jhV׋3DPjhVPj"jhV׋3DPjhVPjhVP_^[t$=3DUjj(hhCVh&Ejj hCVjj(hhhVh&Ejj hhVס0(EjPhhV׃=0(E3D-3Du jhVPӋ 4(EjQhhV׋H(EjRhhVh,IDjhChiVhIDjhChiVhIDjhChiVhIDjhChiVhIDjhChiVhIDjhChiVhxIDjhChiVhlIDjhChiVס@(EjPhNhiV׃=@(Eu'jhVPjhVPjhVP]_^[L$A=3=6t$=3Dh&Ej)j hCVh&Ej)j hhVjjhhVjjhhV0(EjjhhV4(EjjhGhiVH(E_^@(EE3[j j'Pj"g2E_^3[AeAAAcÃ|*; h)E}"ȋ3t uSW|$3ۃdh)E;Wud$Vhui;*D$UhPVzy-l)E ;뉞u;]5l)E^h)E_[;u]5l)E^h)E_[Ã؋~IYL$t;~Gw;}+$ut]^h)E_[^_[_[3; h)EVu&5l)Et Pl)Eft Pvt t t9u Vf)h)E^̃JD$hIDQf$$DPg V$h4DRnt$UV$hP3k W $I$[ujL$jQ 3퍔$hIDRi5D$PC$Pu+j)L$jQgj($RD$(PLf$Qfj$hIDRu)jQPD$EP1gjP$QT$QRe}j$hIDP; jQP$QfjP$R$Pe6D$ 3u3IDut$ V$hPj j_uPL$jQ Vh]^$3Kdj$hIDPj u5hP$Qfh$R$Pd\j$hIDQ u5hP$bReh$P$nQ|d j $hIDRʉ u"$Pr؉$j $hIDQ草 $Rwr؉$́@SVW8(\$4|$83D$ÿ(MDt$3u M 뿿$MDt$3t[MDt$3tGMDt$3tMDt$30jjvPj:2EPVD$L$D$(L$QIT$MD$L$D$hLDzMMMMMMM@M M~MuMiM`uj$4T$PL$ QR=yD$PhLD,L$QhLDhLDhdLD|́@D3ĉ$$ UVL$3W|$ -u5D$ PL^DMDt$ 3t?Fu3^E:u3^E:u3 $bE:u(Ph^E-fE-fEfEfE- fEfEfEfEfEfEh^E; uhkESh^EąPt$~$RqQƒ9l$L$hQ"j\T$ j/R-D$(Pc,$0Ѝ$:u|$+ƒO:uȃ󤋌$0 Q$ RD$P{ $0 Q$ R_[^]$ 36 Ë 1EVWD$PQ\3DT$D$ Rjj =83DPL$jjQjjj52DP֋DjjRjjjP֡tkE DkEjjPjRjP֍D$PjhP׋D$ DT$ jh+QRPjbP֍D$PjhP׋D$ tkET$ jh+QRPj:P֡fE DjPQj8jjMP֋fEtkE DjRkEPj8Rj3P֡D fEkEjPfEQL8QjjH P_^̃ V 2EW? D;=kEfE|P;J~EB8;}> 1EQ 3D1EjsR3DP)E3D_2E1E^ ÍB8;L:8;1ER 3D1EjtP3DP)E3D_2E1E^ Ãt~1EL$QR2ET3DD$P1P\3D52Dj D$j )D$j!jj֋L$ ǍT8j!T$D$$)D$D$P2D_^ Ë 1Eu- D;|JkE;>~9fE8;}-_^ ÃfEH8;|kED8; 3Dl=1EuD;1E=\3DL$QR׍D$P<P׋L$+L$$+Qj8DJu1 3Dj2Dhj3DP)E3D2E_^ ́@D3ĉ$$PSaPbL$jQq$31̃T@D3ĉD$PS\$`NVt$lW|$d$C A$AD$lD u)SL$ QWT3DT$ D$jjPj#2E2jh?@EEABCD́@D3ĉ$ $SVWhL$QT$RPL$$YL$ 3ۃ33 {t^A@tIttttt3t 2Et XHE t XHEu=lDuiP1EhChPPu)SRWL$ VQ诊_^[$ 3{ Ãu#T$  1ER ÜPhQ3D$_^[3; ̃XSUVWj2DPT0D2E1E3jePD$@0|$DD$H`A|$L|$PD$Tt2DD$P2EL$8Q|$XD$\D$`fD$d`KD|$h2D9=<2EuD$ 1E1EQRB  1Eء1EPQ 1E1ERP D$ttt=Du 1EVQ<3D1E1ERP 1E1EQRȡ1E\$l$t$L$;t;t;t9|$t9|$t;t;u _^]3[XƗ_^][X́@D3ĉ$SUVh)EjjjD$Pht8jhPDPPj2D#^]3[$3pĘË 1EhQp2D-0DhgEh1EՋ5(1Dhh)Ejh)ER|PD PDHfPDW-EfPKu8hh-EPh-E pPDtPDPf xPDfH 2EpBEևp=THEuc.S3DO$F;ɒ2EH2EPu+t hH2E0D42E02E ,2ER(2EPQR DPyTS.j] DQM 9@2Eu\K;GhXPDePh(PDv=2Eth-EhPDhFDV hgEI!u0hgEhOD3hgEhhgEhODhgEhODh)EhODS蛑5P2DPS|PԘ_%W$^][3Ę̃V3V4Dtjh0NDhPDV2D3^W(0DL$4D$(|$0Q51E1E=2DVVVT$R;52DSD3DU-H3D$D$Phjj ubk9D$tIpL$;t<=2Et jQ;2Et&}t1E1EL$QRP2DuL$QӍT$RjjjD$Pׅi][t$ 1EQh`KD2D(4D_^̅v6VrPQPQPQu^̅v:VWx3ҊpP x ׃Vu_^Vv+ȍ$u^̃HSUl$T] VuW}@T$~M#Ë# D$#Ћ# L$#׋# T$  #ڋ# t$$ #ދ# |$(#ߋ# D$,#΋# L$0 ## T$4 #ڋ# t$8#ދ# |$<ߋ## \$@ #Ë# L$D ## T$H#‹# t$L## D$P ## |$T ## L$ߍyZ#ڋ ʉL$# L$(1yZL$# L$8t$yZ #΋# L$H9yZ #΋# L$yZ# ʋ# \$,t$\t$3yZ# L$\t$L$<yZ #΋# L$L9yZ #΋# L$ yZ #ىt$\# \$0t$3yZ# L$\t$L$@yZ #΋# L$P9yZ #΋# L$$yZ# ʋ# \$4t$\t$3yZ# L$\L$DyZ #΋# L$T9yZ 33L$n33L$81n 33L$(n 3ȋ3\$H;n3L$ n33T$@2n 33T$0n 3Ë3T$P:n3D$n33L$<1n 33L$,n 3ϋ3\$Ln3L$$n33L$D1n 33t$4>n}} 33|$TEƍnEE U_^UE ][HS\$UVt$N ٍ?;WNsFN@+;rCL$D0FV?;sT$D:V@@;r33L$_+ՍD0^][̃ @D3ĉD$S\$Vt$W~ǍL$ ?88rx+QhDVjD$PVƋjXFL$0_^[35 ̋D$3ɉHH#Eg@@ܺ@ vT2̅vPD$PQ ̃HS_Uo Vw@T$s#֋# ȋD$xjƋ#ˋ# L$)V ȋ#֋# T$鍔p $## \$ ꍴ3ν ## \$$|## \$( *ƇG ȋ#ދ# \$,F0ы#؋# \$0ꍴ3F ## \$4ؘi## \$8 D ȋ#ދ# \$<鍔[## \$@ꍴ3\ ## \$D"k## \$H q ȋӉ\$ #ދ# \$LCyыӉ\$#؋# \$P鍴3!I\$ # # \$ꍄb%\$## \$, @@ ȋ#؋# \$@QZ^&ы#ً# \$鍴3Ƕ ## \$(ꍄ]/Ƌ## \$< SD ȋ#؋# \$P#ً# \$$鍴3 ## \$8ꍄ!## \$L 7 ȋ#؋# \$  ы#ً# \$4鍴3ZE ## \$HꍄƋ## \$ ȋ#؋# \$0og#ً# \$D3L* 33\$(B9Ƌ33\$4 q ؋33L$@더"am33L$L1 8 3l$3(D꾤3t$$K 33\$0`K֋3ڋ3l$<)p 3\$H~(33\$3' 33\$ 0ދ3Ӌ3l$,) 3T$89ً33T$D2 Ћ33t$P|33\$ eV ΋ 3\$D") 3\$0*C Ћ 3\$L3# 3\$( 9 ΋ 3\$DY[e 3\$  Ћ 3\$<3} 3\$ ] ΋ 3\$4O~o 3\$P, Ћ 3\$,3C 3\$H N ΋ 3\$$~S 3\$@5: Ћ 3\$3* 3D$8ӆ GƉGGƉGG ^]G [HS\$UVW|$O ٍ?;ʉOsGO@+;r^_[^_[_[̋L$td$<,tAuVt$j:V)tpj\Vj;tpj/VX;t^Ë^Vt$j:Vr)tpj\V;t^Ë^Vt$WjVA)hUB ;Bs4jD()hihih i @AB ;r]t3_^3[̋D$L$H P H;v H 3̋D$@ 3U-0DVWjj@Ջ3;u _^]S\$D~~ CFC Qj@F;ljFt@9~v;3ҍ$CN,ʉ)hihih i @A;~r΋L$1BVЋK [_N ^3]̋T$VWhDS9;8ust]9+uEtF9+u.t/9+ut9+t3[DI2;1ust]29+uEtF29+u.t/29+ut2 +t3tT$_@^ D$ L$PB_3^ Vt$FFuFW=0DtPV3_^Ul$ VW|$G3vUOIf9t ;r;u _^d] S2Djfx]jfxTWD$P OWPQR83DD$u [_^p] L$AE[_^A3] [_^d] ̋L$Q3Vvt$ 6If91t;rd^3^̸@ ̸@Ul$W3;u _W] |$t }_@] V50Djj@;ǣxHEu ^_] S\$Dxx XKHPj@;Nj5xHEFt=9~v83ҋCN,ʉ)hihih i @A;~r΋l$QVҡxHEE[^%_] ̸̸̋T$VWhDS9;8ust]9+uEtF9+u.t/9+ut9+t3[HDI2;1ust]29+uEtF29+u.t/29+ut2 +t3tT$_@^ D$ L$PB_3^ ̋D$@@̋L$AAu Q0D3̃|$t Vt$FNjjPQ83DF uT$;Vt^ D$t3^ ̸QS0DVjj@3;ƣ|HEu ^[YW|$$Dpxx Pj@;Ƌ |HEAuQ0D_^[Y;~Y\$ 3Ud$Af,f,ADADAD |iD*;|0D3]T$|$yQQHjj@;ƣtHEu|HEPB_^[YL$x=2DjDpH׋tHEf%fj؃B 3fyjfyjfy jfyjfyjfytHEXQPҋL$(tHED$ P|HEQRPt$ 4D|HEQPҡtHEQPҁD$ _^[Ỹ S39\$VwtMU39_~DGL$ t ;o|OtL$ T$ jt3]T$$D$ L$ T$FD$V^ NVO WPQR83Dt D$P$4DL$(tV!t t v^3[ ̋D$T$ W|$PD$L$QRPj_̋D$T$W|$PL$QRjj_W|$jjjjj_̋D$T$ W|$PD$L$QRPj_̋D$NtC=Vt$W=3DjjPhhVhDjj hV_^D$@=3t%=6u4L$hDjQj hQ3D3j)j(Pj2E3̃ @D3ĉD$D$-L$Vt$Wt_3^L$3 D$ tdtT-v=3DD$Pjj hV׍L$Qh0APju7P3DT$Rjj sjV3DpHE=3DPhj htV׋ HEQjj hVjV3D1=3DjhhhtV HEjjhhV׋L$_^3̸ ̃@S3DUl$LVWjjhhqU3D$D$PjhhqUD$(|$,D$0t$EjPhhVjhhh9Vjhhh:Vjhhh;VhT6Ejj h9Vh\:Ejj h:Vhd>Ejj h;V׸$ A=3=6=3DjjhhVjjhhVP6EjjhhVX:EhT6Ehj h9V`>Eh\:Ehj h:Vhd>Ehj h;Vj3j蓒Pj"2E3$ _^34I/B/B/BTBBB/B̋D$-VWjt_3^D$tEt)]jjPj_2E^D$ jP3D_^t$ jhSDV=3D jjhhVD$$׃uL$jh SDV jjhhVD$ ׃uL$ SUjh0SDV jjhhV׃ùjhPSDVy jjhhV׃uˀL$T$SUQR藽jjhhyVPmjV3D][_^jhSDjt$PVfj=3DjxjjhhVjh SDj追PV"j諽jxjjhhVjh0SDj聽PVjmjxjjhhVjhPSDjCPVj/jxjjhhVj\PhhyV_^̃,@D3ĉD$(D$0 $Qj'j RP3D$PqL$,3',̃,@D3ĉD$(D$4PL$hhIDQD$< $Rjj PV3DL$(3,9}9~́ @D3ĉ$$U$WD$PIu+‹$ SVjjhPU3D3~=$(L$QVhRU3DD$Pu+ƒ;||ɋ$,;^[~j2D_]$3 ËL$$ QjhRU3D$_]3 Ul$V>t.W=3DVjhSU׋ƍPu+8Ltu_^]́ @D3ĉ$$SU$PjWC$( jjhQU3D3ۅD$~EV$ T$RShPU3DWt$ 8փ+ʊ1u;\$ |^$][3 ́ @D3ĉ$$NSV$W--]$$@0#B$#B=3DjhEV׋3DPjhFVPjhGVPӸ=3DjhEV׋3DPjhFVPjhGVPӸjL$QhT$RhTDVhD$,uNhhED$PVq=3DjjhhEV׃tjPhhEV׸;VpDEjh`QD۵PV4 D=3DjQhhV׋lBEjRhhVסLHEjPhhVjShV83D$(A=3=6jh`QDV4PɵhhEVpD=3DjjhhVjjhhVDjjhhVlBEףLHEj*jnPj2E3$_^[3  B!B@!B!B!B́@D3ĉ$$NV$W-tLpf$4u-hD$ PVG uL$Qjj h2V3D/=3Djhhh2VhH2Ejj h2V׋hBEjhxQDRVjjhhVVס(DPL$ hhIDQ T$Rjj hVVh,jhehXV׸$ @=3tl=6u{=3DhH2Ehj h2VjhxQDV L$Qjj hVVhBE׍T$R`(D3ɺ,(D;j+j@Pj2E3$ _^3́h@D3ĉ$dSU$tWVD$P|$ǃPu+‹؋ōPu+‹D$LPAǍL =3DjjhhqV׋T$ ؍D$PjhhqVD$$\$(D$,T$8׍L$QjhhqVD$$\$(D$,l$8_][$d3hj2D$p_][3h́ @D3ĉ$$NV$W-A[$ <)B$()BjL$ QhT$RhTDVhD$(ehhdD$PVDjL$ QhT$RhTDVhD$(hhHD$PV=3DjjhhdV׃tFjPhhdV׸[=3DjjhhHV׃tjPhhHV׸%SV@DdvVCEHf EE=3DjQhhV׋DjRhhVסDjPhhV׸[$$A=3=6hhdV@DhhHVCE=3DjjhhVjjhhVEEjjhhVDףDj-jaPj2E3$_^3 )'B'B&B}'B'B̋D$NVW-tFMf|$2u*t$ HEuhHEjj h1V3D_^=$2EkEHEt$ =3DthHEjj h1Vס\HEjPhhV׋ `HEjQhhV_^T$B=3~=6t$ =3DjjhhVjjhhV\HEף`HEHEPu+t>HEkEhkEP0D_$2E3^j/j衂Pj02E_3^̋D$NVW-tPf|$u4t$ PPhhV3DuPjhV3DP3D_^lDt$ =3DSUjPhhV׋ $DjQhhV׋ EEjRhhVh3D-3Du jhVPӡDjPhhV׃= EEt (u jhVPjjhh V׋ DQh jjheh!V׋DjRhhVסDjPhhV׋ PHEjQhhV׋THEjRhhV][_^D$@=3=6t$ =3DjjhhVjjhhVlDjjhhV$DjjhhV EEV D3ɣDQD-QQhhVjjhhVDjjhhVDjjhhVPHE_THE3^j0jPjf2E_3^́@D3ĉ$$NSV$W-$ -,t\Pt D$ Ph0DL$ QhT$RV uuD$ Pjj h{V3Dwjjhh,V3D=3DuPhV׋3DPjjhV׋3DPjh.VPӸ <2E=3DUjQhh V׋82EjRhhVסpBEjPhhV׋ @2EjQhh.VjjhhVסD3+Phhcjheh+V׃=Dj~,jhh,V׋3DjhVӋ-3DPj*jhh,V׋3DjhVӋ-3DPjh.VPjhhh{VhgEjj h{V׸]$$B=3=6=3Djjhh VjjhhV<2EjjhhV82Ejjhh.VpBEV@2ESjjhh,VDׅu DأDhgEhj h{Vj4j|Pj:2E3$_^[3Kjh BuPjvuP3D́X@D3ĉ$T$`NV$`W- $l-~tC=3Djjh hqV׃jPhhqV׸D$HPhP BVh_tP3D|D$HPu+th$IPu+tP$IQL$LRCjjhhV3DuPjhV3DP3DS3Djjh7hqVӃ Pjh6hqVӍT$B$WD (WDO,WDW0WDG 4WDO8WDW_^á WD WDOWDWWDG WDO WDW_^hVDWe_^áVD VDOVDWVDG _^ùVDf_^ùVD_^Ë VDVDWVDG_^ùVDf_^Ë tVDxVDW|VDG VDO fVDfWVDG_^Ë dVDhVDWlVDG pVDO _^= t'TVDXVDG \VDOf`VDfW _^á 6D 6DO6DW6DG _^%=B[=B=B=B=B=B=B=By>B>By>By>By>B=B>B @D3ĉ$$($0V$(Wtyt3$4tPV3DIE=3DPhj hV׋ IEQhj hVjV3DIEPT$ h9$t&Sh AAcPhVcP3Dt3T$RJD$P蝬;ZhWDL$DQ\$D$H0D;u]|$TuV9IEt@?u_^V>WtDSd$FӃ ƒt ȈO>u[_^̣IÉ @D3ĉ$SU$39IEV _D _D_DD$f_DL$ _DfD$ƉT$L$Њ:uW|$+ƒO:uT$RUSjSh 6DSD$0Ph 0D_^][$3R h`@~;ÉEtQ΋ЍI:uMT@U\@E^]ǀX@[$3 Ë$^][3ӡ SVWh4D3^Pw؃thL_DSt[WhD_DST@wQL8Q ;s1Vh@_DSߪƃ Pu+‹T@tD:Q;rϋ\@uS譥_^[jh0NDh_Dj2D_^[̃D$ SUW3h4D3F]P讨;l$ rVh@;PUh@V. +|$l$>#j V;t>[h`@蠟;t5j]V;tF+Ћ :uT@\@oQL$;u99\@t $I\@9\@u\@VƍPI:u+t?Ջ+֊ :uƍP:u+l(ƍP:u+ƒT@L$Qh@V l$VʝU^_][̃T@D3ĉD$PD$XSUl$dV395IEu,UhVPS0DF^][L$P3TÍt$ +uW|$IOuf E(aD?L$hT6E aDGL$ h\:EaD/hL$(d>EaDL$(h!(EEaDL$,hgEaDL$0jhD`DL$8jhD`DL$@jhD`DL$H8dHE`DrL$D`D_L$XHE`DLL$D`D9L$t$`D\$#39\$$W$h]DR.D$ P$QL$$T$$RL$jQt$,`DL$jQ$`DL$ jQ$'`DL$$h$|`DL$(h$Y`D{L$,j)$6 `DdL$0j)$c x`DML$4h$ p`D3L$8$ h`DL$8$ ``DL$8$ X`DL$8$ L`DL$8$ @`DL$8$ 8`DL$8$ 0`DL$8$ (`DkL$8$ `DV$ `DL$8AL$8$ `D,L$8$ `DL$8$ `DL$8$ jP_DJL$@$ _DL$@$ HcDL$@h$_D$$QL$D$ _D|L$D$ _DgL$D$ _DRL$Dh$ _DXD$HL$XQ8;|$L$t$_D\$39\$W$h]DR D$ P$QL$$s$ R| 9l$ }$T$\L$$ _DL$j)$ _DL$jQ$ `DrL$jQ$N `D[L$ jQ$ `DDL$$h$I `D*L$(h$&`DL$,j)$`DL$0j)$0x`DL$4h$]p`DL$8$`h`DL$8$d_D~L$8$h``DiL$8$lX`DTL$8$pL`D?L$8$t@`D*L$8$x8`DL$8$|0`DL$8$(`DL$8$ `DL$8$_DL$8$`DL$8$`DL$8$`DL$8$`DmL$8$jP_DL$@,$|_D=$@t4L$h$_D$2$ #3 $d$D :uL$h$_DL$$_DL$$_DL$$_DL$h$_DD$$ Q$ jR);|$KL$t$_D'D$PD$a]D$_^[$ 3AĄ Ë$ _^[3'Ą SVt$ Wt6:utB:Guu3u _^[+_^[̸BƓ@D3ĉ$BpBESUVWzD$P0ND{L$hhcDQ\$$T$Rh]DXXHEL$Ph`DQ =XHEkQR<kEt$T$8?aD\HEPL$XhaDQ`HED$`PRhaDPt$xBEaDHt$BEaD5$?Q(CEt$ $?aD,DD$ RhaDPh 0DT$,QhaDRRtBEL$8PhaDQ=4DD$DRhxaDP' CET$P@QhpaDR|CEL$PhdaDQCED$(RhXaDP 8DT$4QhLaDRP6EL$@Ph@aDQX:ED$LRh4aDP `>ET$XHQh(aDRt$T6E aDt$\:EaDt$d>EaDt$h(EEaD$>Ph0DL$Q$>gEaDlt$hD`Dt$hD`Dt$hD`DdHED$ Rh`DP DT$,Qh`DRDL$8Ph`DQL$DcDE$ Rh83hD$PUW$>h]DQ脄\$T$ R$?P}\L$Q$ T$ `DGT$R$ T$u`D-D$P$ $`DL$ Q3$p`DT$$R$$M`DD$(P$$* `DL$,Q$$W x`DT$0R$$$ p`D$?P$pL$8Q$ $?_DS$0L$h]DP΀L$ $>u |ˍ$(+Q>$`R3W eW$>h]DPk\$L$ Q$?Rd$\L$Ph_DQT$ R$<+$p_D$\D$P$Y+$`DL$Q$+$`DT$R$T,$`DD$ P3$`DL$$Q$0$`DxT$(R$c<$(`D[D$,P$<$(x`D>L$0Q$<$(p`D! $)u$>R$/ 3$+>uD$P$+$>_D$=$)QL$h`D$=L$R$)_D$=$)L$ P``D$=$)QL$(X`Dj$=L$(R$)L`DM$=$*L$,P@`D0$=$*QL$48`D$=L$4R$*0`D$=$*L$8P(`D$=$ *QL$@ `D$=L$@R$,*_D$=$0*L$DP`D$>$8*QL$L`De$ >L$LR$D*`DH$>$H*L$PP`D+t$T$P*@Q_D$=L$R$*_Dt$$ P_D:$=$$*QL$$_D$=L$$R$0*_D$>$4*L$(P_DL$,Q$ >$@*_DFD$Z$\RWyD$Wh_DP }7W$>h]DQ{L$ $>u |Fu3T$Ph_DRO D$D$$B_^][3sBIEVt$tVpAVhcDN ^Ë^́@D3ĉ$ $SU$$VWT$D$$4RPL$Уh< TFDXFD ^E^E#P3ۊ:u+^EIG:uf:Dft u^EG:uf ADf跾I:u^E+O:uȃ设t 褾u#^E$G:ufADfōP$:u+ŋ͊:u^E+O:u~LFD PFD^Eň ^EP3ۍ$:u+t[^EH:ufcD cDfHŋ͊:u^E+IO:uȃ󤋴$0ƍP:u+t#^E$G:uf:Df^E+֍I :u3LbE:uL$$(QjfEfED$ h^ERfEAfEfEfEfEfEfEfE$,_^][3iṕ@D3ĉ$U$W3|$D$ CV$(VPUrWD$$PjhL$8QS$Ll$0H@$|$3~Lt t ;|pWT$RjVD$,PS@$(VQGuD$WT$(RP~|$ )$<|4 tKL$QT$RjhD$,PS?^|$uh DDFu L$ F$(RjUq t u^^_]$3nÊE~+_^][Ã|$u h DDdE3hdDUE_^][̋L$*Y B$B`gDø8gDøgDøfDøfDøfDøfDøfDødfDøHfDø$fDøfDøeDøeDø|eDødeDøPeDøj/Ph\ ۱uD$j/j>PH\ {uD$ L$T$VPQRL$ PjȸQ| j!^S\$3t|Vt$~mUl$ W|$L$ UD$PQVWSy6|$tt(+_]^[hgD3\<_]^[3^PhgD_]^[̃Vt$tD$PjVWf l$3|$D$SUW|$,D$IL$(\$h(W3Wh6D;t^9l$~$T}u=D$PP͐Eu|$+Gu̓t$L$QuD$_^][3^Ý@D3ĉ$U$VWhD$jP[$$T$ +Њ u8L$ t$ tiSIj/VxatjjjV@؃u(t wuɋ[_^]$3XjjjUԋ$_^]3zXV3Ʌ~-SW33<;|_[^́@D3ĉ$$$SUVWD$P$T$T3һ#EgܺvT2\$Dl$Lt$<|$@D$4ÉT$HD$8T$,T$0 $$$tD$PPj@L$`jQ蝐D$(?@sD$( D$(@D$(T$8P+RD$`P$fL$4 L$8@}{T$, ;щT$,sD$0|$HuDXD$(D$H@}@+RL\jQXD$4 8T$X:D$0L$,$$8"D$,=D$,sD$0T$X@-L$43#3NjT$XyZD$\3#3Ѝ:yZD$`3#3荄.yZˋD$d3#3荄.yZ3ӋD$h#3/yZˋD$l3#3荄.yZӋ3D$p#3荄/yZˋD$t3#3荄.yZӋD$x3#3荄/yZˋD$|3#3荄.yZӋ$3#3荄/yZˋ$3#3荄.yZӋ$3#3荄/yZD$3ڋ$#3؍+yZ|$D$T$3#3Ë$yZD$|$D$͋3#3苄$(yZT$T$D$3D$xl$3D$`33D$X#|$D$ljL$L$3D$(yZl$D$D$|3D$d3D$\L$L$3l$ D$L$3#L$ $T$$ЋD$3ʋT$yZT$D$D$ D$D$D$ $3D$hT$3D$`3T$3$#T$ 3T$L$ыL$ yZT$$D$ T$T$D$D$D$ T$3T$3$#T$ 3D$l3T$3D$dL$ыL$ yZT$$D$ T$T$D$D$D$ 3$T$3D$p3T$3D$h3T$ L$ыL$ nT$T$T$$T$D$ D$3T$D$D$ 3T$ $33D$tL$3D$l$ȋD$ ыL$ nT$T$T$D$D$D$ $3D$xT$3D$p3T$33T$ L$ыL$$D$  nT$T$T$D$D$D$ $3D$|T$3D$t3T$3$3T$ L$ыL$$D$  nT$T$T$D$D$D$ $33$T$3D$xL$$3T$3T$ ыL$D$ nT$T$T$D$D$D$ $33$T$3D$|3T$3T$ L$ыL$ nT$$D$ T$T$D$D$D$ $3$T$3$3T$3$3T$ L$ыL$ nT$$D$ T$T$D$D$D$ $3$T$3T$33$3T$ L$ыL$ nT$T$T$$D$ T$D$3T$D$D$ 3T$ $3$L$3$3ыL$ nT$T$T$$D$ D$D$D$ $3$T$3T$33$L$L$ 3֋t$2nL$T$$T$L$ L$$L$$3$T$T$T$333ˋ\$t$T$ 3\$nt$$t$t$t$ڋT$$$t$\$T$ T$$T$$3$33t$ 33$‰$T$$T$nt$T$$T$T$T$ t$ t$$t$\$3ڋ3$T$3$T$ 3|$3ߋ|$;n\$\$\$T$T$|$3$\$3$3\$3lj$|$$3ߋ|$;n|$\$|$|$l$$3$3$$3$\$ʼn$l$T$$3ڋT$3ݍn\$l$\$\$T$$3$3$l$3‰$T$$33T$*n|$|$l$|$|$T$$3$3$l$3$3‰$T$$3T$*n\$\$l$\$\$T$3$3$l$3$3‰$T$$3T$|$|$*nl$|$|$T$l$\$3$33$\$3$3‰$T$$T$*nl$\$\$T$$3$3$l$3$3‰$T$$3T$*nT$T$׉T$$3$3$|$|$3‰$ #T$l$\$# $\$l$*ܼT$T$T$T$$3$|$3$l$3$‰$ #T$# $l$*ܼT$T$T$T$$3$|$3$3$l$‰$l$ #T$\$# $\$*ܼT$T$T$T$3$3$l$3$|$‰$ #T$# $|$l$3$*ܼT$T$T$T$3$3$3$3$3$\$‰$ #T$l$# $l$*ܼT$l$T$T$l$|$\$3$ 3$#l$؋D$D$# l$3ܼD$D$D$$l$ #͉|$|$# $9ܼL$$3$L$3$L$3$T$$ #‰l$l$# $э(ܼD$3$D$3$D$3΋ #|$#l$ l$$ .ܼt$$|$D$ #‰t$$3$l$3$T$3$T$# ‹T$l$ƍ(ܼD$T$׋$3$D$3$D$3$l$lj$ l$ #|$T$# $ T$/ܼ3$T$3$T$3$T$T$ʼn$$D$ #l$# D$$$|$|$D$D$D$3$/ܼ3$|$3$$T$l$$(l$ #D$# $(T$(ܼD$D$$ 33$3$T$T$$,l$l$ #D$|$# $,|$(ܼD$D$D$D$$$3$3$l$3$T$$0 #D$# $0T$l$(ܼD$D$$(3$T$3$T$3$|$$4 #D$#l$ $4l$(ܼD$D$D$D$$,33$|$3$$8 #D$T$# $8T$l$l$(ܼD$D$$033$T$3$T$$< #D$l$l$|$# $<|$(ܼD$D$D$D$$43$ 3$T$3$l$$@ #D$# $@T$l$(ܼD$D$$83$$T$T$33$|$l$$Dl$ #D$# $D|$(ܼl$|$|$D$$<3$(l$3$33$3$H$HD$D$T$(bʋD$l$D$D$T$$@3$,3$l$333ڋT$T$더*b|$l$|$D$$D3$0l$3l$33$|$|$T$T$3艄$P*bʋT$l$T$T$D$$H$LT$|$3$4333$3$T$TD$D$bʋT$T$׋|$D$3$8T$3$ l$3L$33ϋЋD$D$bʋD$D$D$L$$P3$<|$3$$$X3$\L$33$\L$l$bʋL$$T3$@3$(l$3$ D$Ɖ$`3l$3$`.bʋD$|$L$l$3$D3$,3$$l$$d33$d/bʉt$$\3$HD$3$03$(L$ʼn$h33$ht$t$|$.bʋl$$`33$43$,L$$l33$l|$|$l$8bʋ苄$d3$P3$83$0t$L$$pl$3l$3$pt$(bʋ|$|$L$t$$h3$T3$<3$4$tt$33$tl$0bʋl$D$$l33$@T$3$8ȋ33T$t$bʋ|$|$D$$p3$\3$Dt$3$<3ЋD$3D$bʋt$t$l$l$l$ 苄$t3$`3$Ht$3$@33t$ l$l$|$.bʋt$l$$x$|$t$l$3$dt$ 3$h3$l3$P33$D3$H3$Tt$3l$t$3|$|$t$ t$/bʋl$t$t$ l$‰t$3l$t$3É|$|$t$ 3l$ T$/bʋ|$T$T$ $T$T$3\$D$3$$3$pb3$X\$3$Pl$|$D$3D$3(bʉ$L$$3$tT$43$\l$3$TƉ$3l$L3$Ë\$D|$@|$bʋt$<|$(8\$Dl$Lt$<|$@AD$TL$4x _p^hH$][3<Č̋D$L$T$ PQjjý@D3ĉ$$SUVWD$(Ɖ|$$Pu+yu+ύ,MQ;؃ Ӌ+֍ uD$$Њu+ƒOuȋ$u'T$,R(UD$4SPr'L$S0DD$ jT$tjOu |$ u3[ JEjhPV,&1_^YQ JES\$ VW|$ j;hPS+L$T$QRS+D$ uiU-0D397t$$u4jT$(tju?t֋t$$?tt VhD 3'tD$]_^[Y]_^3[Y*PhpDa _^[Y̡ JEVt$j(hPV*t L$ QV*^QVt$ WD$jT$ t-jT$ tj0Duċ_^YÃ|$uUl$SD$UPV*؃u)/*j0Dxt3't̋[]_^Y JEj;hQS.*uS[]_^ỸS\$(U3W|$4+/9-(DD$4l$0tD$P19/Vt$$jT$8jT$8trj0DtP9-(DtNL$Q1T$D$ L$)T$ȡ(D;ʉL$|!9D$rhD 9/^l$89l$4uM9/uI9+uE|$0\$,l$(t$$WSUV!)D$8u!(j0Dt3't^_][uËD$(̃S\$(UVt$4=(DWD$4t D$P0 JE|$$j;hQW`(wu>jT$8jT$8jj0D!tQ=(DtNT$R0D$T$ L$)D$(Dʙ;ʉL$|!9D$rhĉD>\|$4uQ>uL;uG|$0\$,l$(D$$WSUP'D$4u!,'j0Dut3'tɋl$4_u _^][_^][QVjb{T$Y;u ^^Ỹ0V3W|$@jD$ 0t$D$Bt$t$|$ t$$t$(2DPT0DD$(D$Pt$0D$4hDt$82DL$ t<R/V3VtkjL$DQP0 u"D$T$RPL$\QT$LRU~D DDD$DL$f DT$D$ fL$$eDD DT$DD$fDL$T$ fD$$1 |DDDL$ DT$DD$L$ T$$D$Pjj hW][:53Djj(hhWjjPhhWjhdDjW&$_^3"ĜjhPBTPhiP3D́@D3ĉ$$$ t$R$RQ$  SE;u<$Rhj Q83D$PKC3$3!SE $Qhj R83Du|PjPD$ P}fhkEj3$3! uR;SEu%ȗP3D3$3Q!賗P3D3$3,!$RQhPSEP3D$3 ̡SE̡SE̡SE̡SE̡SE̡SE̡SE̡SẼ=SE"SVW(3D؉\$ 3賖;uUWD$o=3DjhiV׋2DPjhVPjhVPjhjVPjhVPjhVPjhޜVPjhVPӡSEjhhPjhiV׋2DPjhVPjhVPjhjVPjhVPjhVPjhޜVPjhVPӋ SEjhhQ-83De9D$nu,|$~%SEPhJhRjhJVPj#SEjhJhPjhJVPjhVPӋ SEjhIhQjhVPjhIVPjhVPjhߜVP蹔9D$mujjhVPmu9|$~2SEPhIhRjhIVPjhVPj0SEjhIhPjhIVPjhVPjhߜVPӋ SEjhJhQjhJVPjhVPғ9D$ ӓ9D$SEjhJhRjhJVPjhVPӡSEjhIhPjhIVPjhVPjhߜVPӋ SEjhKhQjhKVPӋSEjhLhRjhLVPӡSEjhMhPjhMVPjhaVPjhœVPjhVP]_^[Ã|$~H SEjhKhQjhKVPӋSEjhLhRjhLVPjESEjhKhPjhKVPӋ SEjhLhQjhLVPjhaVP9D$tALkt7SEjhMhRjhMVPjhœVP]_^[áSEjhMhPjhMVPjhœVP]_^[S2DU-3DVW=83DSE3DjPPPӋDSEjQhR׋D SEjPhQ׋DSEjRhP׃$r SE53DjQ֋SEjR_^][̃=SES2DU-3DVW=83D3DjPPPӋDSEjQhR׋D SEjPhQ׋DSEjRhP׃$r SE53DjQ֋SEjR_^]SE[Y̡OEAjt4ItSEhehP83DË SEhRhQ83DËSEhQhR83D̡OE̋D$XueShpDX ~ZD$VWPV=pDpDt,IVWyt ƍPu+8Ltu_^[_^A[Ë[̡OE D̡OEjt4tSEhmhP83DË SEhkhQ83DËSEhlhR83D̡OẼ=OEIV583DttSEjhkhP֋ SEjhlhQ֋SEjhmhRփ=OEtSEjhhP^Ë SEjhhQ^ËSEjhkhR֡SEjhlhP֋ SEjhmhQ֋SEjhhR^̃=OEtSEjhhP83DË SEjhhQ83D̡OE̋D$L$T$ OED$ OEOEOE̋D$39T$Vu8 OE;u;‰ OEt tOE^É OE^Ãt4 OE;u;‰ OEt OEu OE^ËD$w$BOEáOEáOEáOEËD$ÍIBBBBD$$EE̡$EESVW=Djt@SEhghP83D=3DjhgV׋2DPjhfVP_^[Ë SEhfhQ83D=3DjhfV׋2DPjhgVP_^[̃=SEtSEjhhP83Dj SEjhhQ83DjhP3DP2D̡SE̡SEV583DW|$ WjhXPփt SEjPhDQ֋SEWjhCR֡SEjjhFP֋ SEjPhNQֺKE+_^ uáSEVt$W=83DVjhXP׃u SEVjhCQ׋SEVjhXRjPSEhNP׺OE_+^ uVt$ W|$ VjWVhOEW_^Vt$ W|$ VjWVhKEW_^hOE0DVWjhvb53DP֋=2DP׃=Dujhv;PP_^́ @D3ĉ$$U-3DVWhDhoPS3hD$ƍPu+t8OQV PT$h؋DR ̋D$,D$PQRSՁkD|jjhSՋ$_^]3 Vt$ W|$ tv!w_^SEPjW43DL$T$SEQRVWP3D_^Vt$ W|$ tv!w_^SEPjW43DL$T$SEQRVWP3D_^Vt$ W|$ tv!w_^SEPjW43DL$T$SEQRVWP3D_^́@D3ĉ$SUV$0Wj$4j=00Djjjj h DjgVjjhPSׅ-43DSEt5hBjPգSED$PS\3DL$SEjjQjjR`3DjjjjjjhDjhVjjhPSׅ=83DSEhBjPՋ SEjjSEDPjjQ`3DSET$RjhP׋L$hD+L$jjjjhjjjjjjjQH0DSE DjVhGRT$$hSED$,+QRPhBPh 6DhDh3DSEjP2DSEthBjPգSESE SEjPj0Q׋SEjhhAR׍D$$Ph0Dd|$$D$ l$$t@MQq/ȋD$$Au UjU}u SEjjhNQ׋-43DjjjjjjhDjhVjjhPS00Dȅɉ SEh@BjQՋtkE kEjjRSESEDjQR`3D SED$PjhQ׋SED$ tkEjVhHRT$$h+QRPhBPh 6DhDh3DSEjP2DSEthBjPգSESE SEjPj0Q׋SEjhhARסSEjjhNP׋ SESE=SE_^][t=SEtt =SEtu3$3 Ë SE뵋$3̋ ËD$OEB̋D$-Qt#tOEX!OEIOEA̋D$OE̋D$-kt-tOEQOE=OE)̋D$OEb̃5OET̋D$SEB̃5SE4̃V395SEDt$%\uD$SUWV03;ut2DV53DhD |$hJWShDhWS֋D$hpDhPShdDhKUShTDhLUSh@DhMjSjjhSh(DhœjSjjhShDh[jSփ|$0u L$Q,3D'T$RPT3DD$L$ D$L$j:T$PD$jRPjS2DS2D_][^̃=SEkSUVW3Zuhj׌3ux3t2D V53Dh*t1?tP[(QP(;?uh?u _^][ÊR(P(;t>uWVdu8t[Fu_^]3[Êu tt .u~tu't_w ~=v@ }t#MapLE}*tE`p3jt$TYYUu MUzt}tE`pEE MVDtzDtp=҃+r  j~Z; !+ ȋ]]w!ȁ~w!r}t#MapfD}*tE`p3^jt$YYËD$ StRT$3ۊ\$ t 2trt2urWߋ_t 2t@u[Ãr 3˿~3σtJ2t#2t2t 2t_B[ÍB_[ÍB_[ÍB_[QL$+#ȋ%;r Y$-j jt$ c j jt$ UWVu M};v;r=}EtWV;^_u^_]aur*$CǺr $C$C$CCDChC#ъFGFGr$CI#ъFGr$C#ъr$CICCCCCCCCDDDDDDDDDDDDDD$CC CC,CE^_ÐE^_ÐFGE^_ÍIFGFGE^_Ðt1|9u$r $C$@CIǺr +$C$CCCCF#шGr$CIF#шGFGr$CF#шGFGFGV$CIDCLCTC\CdClCtCCDDDDDDDDD D DDDD$CCCCCE^_ÐFGE^_ÍIFGFGE^_ÐFGFGFGE^_U(SVu Mu3;u(?SSSSS;?8]tE`paE~EPjP{ H;tFɍEPSSVT=YPEVP蓂@8]tE`p^[jt$LYYUQQS]V39ME Wt -F؋M u uPS衉 ]؋vW0FwrwNNG;r_^[UEjuu u}E]øCDDCDLCDCDCDD CD CDvCDC訔|$SEt2V<Yri<\t\t /t@:u8t)@8t$:t\t /t@:u8t8Pu3@3UVW=0=u u u# i=t0$8"t3Q=ju 0jM _^]U$h@D3ʼnSV3;Wuu$=<SSSSS<;thDVYYt<j^0<0~:u:t8^tPߘY`jEEPV0DEhDV]脙YYtEPhVP;tqVM:Yt %t\V1DvP9]t uYjSSSjjhE]]]buʃG W$GOG(O,h9]uY9]u 9]u_ _$ZEPEP0D]EPEP0DGEjPEPEPEPEPEPɓG W$9]u9]uG GG$GZEPEP0DEPEP0DEjPEPEPEPEPEPWGW9]u9]uG G(G$G,REPEP0Dt}EPEP0DtkEjPEPEPEPEPEPG(W,u0DVufGEGEHYGYfGf_f_ f_ 31DPP:Yu0D_^3[}UVuMU3;u/9VVVVVv9}tE`pS] ;u/9VVVVV?9}tE`pE9pu$EPSR }uMapiWf BDUtY:u3ljpMjQjJRWp EP$ufEfEfMffEEэ At ff CDtU;u3hjpMjQjKQWp EP`$ufEuHfEfMffȋECэ At ff;u,ft 9M u H9U t @ff;u9M u8]tMap8]tE`p3^[jt$ t$ 7 UVu Mhu~u uk-YM3D2tA9t@Au}tMap^jt$YYt$1Du1D3t P/Y3UMUS3;VWu;u9] u3_^[];t} ;w.j^0SSSSSQ.;ˋut;u֋8t@Ou;tu@F:t"Ou;v@F:tOtMu9]u;u}uE jP\Xn;.j"YuUSVu39]Wu;u9] u3_^[];t} ;w-j^0SSSSS-9]uʋU;uу}u @B:tOu @B:tOtMu9]u;u}uE jP\Xx-j"YU}u3]uu u E]jt$ t$ US39]VWuM#9]u.-SSSSS,8]tE`p} ;t˾9uv(,SSSSSo,8]tE`p`E9XuuWuǏ 8]tDMap;EMQPEMQPzGMt;t;t+3_^[UV395lTEu99uu>,VVVVV+'9u t܁}w^]/Vuu u^]USVu M];sTM胹~EPjSgM Xt}tE`pE胸~1]}EPE%PYYtEjE]EYE+*3Ɉ]EAEjpUjRQMQVpEP$ouE M3e }tMap^[Ã=lTEuD$Hw jt$YY̋D$L$ ȋL$ u D$S؋D$d$؋D$[UWVu M};v;r=}EtWV;^_u^_]lur*$CǺr $C$C$HCCC(C#ъFGFGr$CI#ъFGr$C#ъr$CICCCCCxCpChCDDDDDDDDDDDDDD$CCCCCE^_ÐE^_ÐFGE^_ÍIFGFGE^_Ðt1|9u$r $PC$CIǺr +$TC$PCdCCCF#шGr$PCIF#шGFGr$PCF#шGFGFGV$PCIC CCC$C,C4CGCDDDDDDDDD D DDDD$PC`ChCxCCE^_ÐFGE^_ÍIFGFGE^_ÐFGFGFGE^_jt$1Du1D3t P 'Y3U$X(@D3ʼn`DVtj I6Y{tj}Y`D]|ux}tfff]pfElfehfmdE@jPEjPE EЍEjE@uE1DEP1Dj*UW}3كE 8t3_jh@DG3]uu EYu u SUY=(}E3}j'Y}S;(YE;;5}EwIVSP- t]5V/YE;t'CH;rPSuS'ESP (9}uH;u3Fu u VW5TE1DE;t CH;rPSuSu'E.}u1uFu VSj5TE1Du ]j%YË}9=YEt,V5Y?$9}ul1DP#Y_$9}th quFVSj5TE1DuV9YEt4V]5YtvVM5Y# 31#|u#1DPd#YUM S3;v(j3X;Esz#SSSSS #3AM9]VWt uوYVuYYt;s+VjS _^[]USVW}3;t!9] v!;u W ;E YYr'9] t"j^SSSSS0t"uM8tbUŠPt9EjpMjQjWhp EPU$;t}+߃)}};]rh}t3;v uu+ ;w;EPuVL0YP艊 E+)E(V~@Y}tNMEFKMEE3} tu Vu jVVVV"Vt} tu ju ?"3PPPPPGN +3u?N j hD'3u9ut79ut29uu5} tu VuS VVVVVl3'u1Yuuuuu uEEEu 2Yt$t$t$jt$S*t$(5pDhЃ hD1DthDP0Dtt$t$Yt$1DjmYjYV tЃ;t$r^Vt$3utу;t$ r^ËL$V3;uVVVVV<jX^áTE;tډ3^ËD$V3;utVVVVVjX^95TEtۋ TE3^Ã=DthD~Yt t$DY#nhT4Dh84D6YYuTVWh/CH04Dƿ44D;YstЃ;r=@}E_^th@}Ez~Yt jjj@}E3jhDJ%jY3}3C9@TEt~t>;tWYhd4DX4D2Yhl4Dh4D"YE}u(@TEjYu3C}tjsY$jjt$  jjt$ jjj jjj VV'V聉VVkV[VyVV8h,Ci$pD^U SVW39} t$9}tu;u'WWWWW3_^[ËM;tڃ3u 9Ew͋} }fF M}tFEEN t/Ft(;؋rWu6p)~> +}O;]rOt VD+Yu}}t 3ҋu+WuV*YP ta;NjwM+;rP})EVP{CYYt)EFKEEAEN +3u N Ej hD}"39u t)9ut$39u;u VVVVVQ3"u,Yuuuu u@EEEu,YÃ=LTEu%t$#h,YYf=@MZu3<@@PEu"f@ ut@v39@3j`hD!eEP1DEWj1DP1Du jVY>V0DVjuP1DlFEFE܋FE؋~ P1DutM܋U‰5TETE TETE=TEE3CSYujYujYd]9}jY1D,}E;DTEx}jlY}j [YSpYtPIYt]tMj YQPjh@E}uP.E MPQyYYËeEԉE}uPEE3@ËeE 訑-t"t t Ht3øøøøSUVWU3^WSA~~~ 3~xD +Ɗ  CMuANu_^][U$d@D3ʼnSWEPv1D3@;rEƅ t+];w+@P j R CCujv EvPWPjjВ3SvWPWPWv SqDSvWPWPhv Sq$3LEtLtL Ƅ@;rME3)EUЍZ w Lр wL р A;rŋ_3[肽Ŝj hD DGptltwhuj uYj 8Yewhu;5Dt6tV1DuxDtViYDGh5DuV1DE뎋uj YUS3SMPPTEuPTE1D8]tEMapEDD;FG;v}FF>uыuE}urlj{CjC CDZf1Af0A@@JuL@;vFF~4C@IuC.C Ss3{95PTEbM_^3[腺jh(DM}_huE;CWh uY؅Fwh#SuYYEuvh1DuFh=xDtPSY^hS=1DFpDj YeC`TECdTEC hTE3E}fLCf ETTE@3E=} LD@3E=}D@5D1DuD=xDtP蚷YDSE0j B Y%u xDtSdY eE_Ã=<}EujVY<}E3SUVt$3;Wto=0Dth;t^9(uZ;t9(uPYY;t9(uPͶ虎YY赶誶YY;tD9(u@-P艶+Pv+Ph]=pDt9uP脌76YYj~P[Dt;t 9(uPY9otG;t 9(uPYKuVY_^][SUVt$W=1DV׋tP׋tP׋tP׋tPj^P]{Dt tP׃{t CtP׃Mu؋P_^][Vt$tSUW=1DV׋tP׋tP׋tP׋tPj^P]{Dt tP׃{t CtP׃Mu؋P_][^Åt7t3V0;t(W8YtVR>YuDtVxY^3j hHD_DFpt"~ltpluj 1Yrj YeFl=DiEEj YuUQQSV3EF3Pu]}Y~BWS1Dp<f9^F|0v#WhHD9iYYtFC(;reE_^[V5D51Dօt!DtP5DЅt&h`D1Dt#JthPDV0Dt t$ЉD$D$^jYV5D51Dօt!DtP5DЅt&h`D1Dt#thpDV0Dt t$ЉD$D$^1Dt$5D1DDV5D1Du5TEPYV5D1D^t$t$5TE)YDtP5TE YЃ DDtP1D Dj hhDh`D1DEuF\D3G~t/t&hPDu0DӉhpDuӉ~pƆCƆKCxDFhP1Dj CYeE FluDFlvlYEj 2YVW1D5DЋuNhjynYYt:V5D5TEYЅtjVYY1DN VY3W|1D_^VujY^jhDuF$tP趰YF,tP訰YF4tP蚰YFC5TEYЃDtHhjKkYYt4V5D5TEYЅtjVYY1DN3@l3^_̋L$t$tNu$$~Ѓ3ƒtAt2t$tt͍AL$+ÍAL$+ÍAL$+ÍAL$+ËD$TEU$X(@D3ʼnV]|ux}tfff]pfElfehfmdE@jPEjP:EEЍE؃ E uEp1Dj1DEP1Du uj(Yh t1DPx1D3^׭ŨU5TEYt]jY]D$3;͠DtA-rHw j XËͤDDjY;#buDÃOu Dà VL$QY0^UQQVE3PuuYt VVVVV;EPYt VVVVV }^u }r3@jX39D$jhPh1DTEu3}(}Eu$hYu5TEl1D%TE3@VW3TE<DuD8h0qYYt F$|3@_^Ã$D3S`1DVDW>t~t WWk&Y8D|ܾD_t ~uPӃ8D|^[UE4D\1D]j hD 3G}39TEuij hYYu4D9tnjfY;u 3Qj YY]9u,hWpYYuW蛩Y ] >W耩YE E j *YUEV4D>uP$YujY6X1D^]h@j5TE1D}EuËL$%UE%}E}E3 }E }E@Ë }E}EkT$+P r ;r3UMAVu W+y iDMIMS1UVUU] utJ?vj?ZK;KuB sL!\D u#M!JL! uM!Y] S[MMZU ZRSMJ?vj?Z]]+u]j?u K^;vMJ;։Mv;t^M q;qu; s!tDLu!M!1K!LuM!qM qINM qINu ]}u;M ыYN^qNqN;Nu`LM Ls%}uʻM DD )}uJM YJꍄ ED0EUE $}E5d1Dh@H SQ֋ $}EUE PUE@ $}EUE@HCUEHyCu `UExueSjp ֡UEpj5TE1D }EUEk}E+ȍLQHQPE }E;UEvm}E}EEUE=$}E[_^á }EV5}EW3;u4kP5}EW5TE1D;u3x }E5}E}Ek5}EhAj5TE1D;ljFtjh hWT1D;ljF uvW5TE1D뛃N>~}EF_^UQQMASVqW3C}i0Dj?EZ@@Jujhy hWT1Dup;UwC+ GAH@PǀIuˋUEO HAJ HAdD3GFCENCu x!P_^[U MASVuW} +Q iDMOI;|9M]UE;;MI?Mvj?YM_;_uC sML!\D u&M!ML! uM!YO_YOyM+M}}M O?L1vj?_]][Y]YKYKY;YuWLM Ls}uϻM DD }uOM YO U MD2LU FBD2<38/] )uNK\3uN?] Kvj?^EuN?vj?^O;OuB st!\Du#M!NL! uM!Y] OwqwOquuuN?vj?^M yK{YKYK;KuWLM Ls}uοM 9DD }uNM yN ED3@_^[U}EMk}EMSI VW} M 3U }ES;#U# u ;؉]r;u}ES;#U# u ;ى]r;u[ {u ];r;u1}E {u ;ى]r;u؅ۉ]u3 S@YKC8t}ECUt|D#M# u)eHD9#U# uEUiDMLD3#u#Mj _G}MT +MN?M~j?^;J;Ju\ }&M|8Ӊ]#\D\Du3M]! ,OM|8!]u ]M!K]}JzyJzyM yJzQJQJ;Ju^LM L}#} u ;οM |D)} u N {MN 7Mt LMuэN L2uɍy>u;UEuM; $}Eu%UEMB_^[hQCd5D$l$l$+SVW@D1E3PeuEEEEdËMd Y__^[]Q̃S\$ UVs35@DWD$D${t N3 88N F3 8(D$(@fk L$0T$D$L$ St^DmLɍ\D$t\D$|DLD$ù|$t$t N3 8豞N F3 8衞D$_^][D$ƋL$(9csmu*= }Et!h }EWtT$(jR }EL$,D$,9h th@DWՋD$,L$H t N3 8N V3 :K{ Ph@DW˺QS\$ VW33;8DtGrwUjwY1jwYu =tD?hPDSVEUQ t VVVVVhVEVjWE(1Du&h8DhVQ t3PPPPPIV@+~,WPVxYPc ;uF yF N _Ff^[Vt$u V3Y^VYt^fF @tVPuYY^3^jhD.3}}jY}3u;5}ElE98t^@ tVPVYY3BUlEH t/9UuPPYtE9}utP5Yu E܉}F3ulE4VYYE}EtEjYYjYøDá}EVj^u;}ƣ}EjPQYYlEujV5}EzQYYlEujX^3ҹDlE  pD|j^3ҹDWk8kEt;tu1 B`D|_3^;=8TEtu5lE貓YVt$D;r"PDw+Q)N Y^à VX1D^ËD$}PD$ H YËD$ PX1DËD$D;r=PDw` +PYà P\1DËL$D$}` QYà P\1DË9D$uH;L$jPu,PYYu3ËD$ 6t$ 7謣 QmP tԉ&3@Jx A Rt YST$؃tP葠Yu[U$t@D3ʼnSV3W;EEu}؉EE^]]]u -SSSSS ;tF @VgYt.V[Yt"VOV]u ]Fƅs oUjF<-uHtD]t=F:sŠ:w(*ЋσdzhGJu]2ȊЋh]<]uu؋u+uMu tEUE~؉]0UEe؀x]tGXtB}xEt}tMuEEoMt uSkYYj0[UE }؉]t m}}EExFuLGFMt uP=kYY;}DEăc8}Et f &E]-uE+uMu tEUEX؉]}}}xtO}ptIPY}ou8EЋuEKjj uuU5W*YtVEЋuWE蒕Yu߃]ECЙUЃ}utMt(UE؉]GMt uSiYY}}E̋M؃ىẺM}}}xt)}pt#PYta}ou 8}V-k (VRYt>VǔYu߃]E}|tMt%UE؉]Mt uS/iYY}t߃}Fue}}u&Eċuȃ}t ẺEЉF }t>f>}EG}BUETG;É]}u_P<YtUE+G;ȉ}u+M}u?%u?E؀xnu6p(}t uPahYYt uuOhYY}u uWY}uEąu8Eu}tMap}tE`pEċ_^3[貇ŌVt$W3;u)WWWWWF @t F f F u ViYFvvV2YPoI ;ljFtF uOV Yt.VYt"VV%uN@ uNhF P;JYYt7F N@Cg5kEP1D33@ËeEU]ES3Vu E]]]F> t tjVhtDn udh|DVYYu M ;hDVYYu M hDV̜YYuM F> t8tSSSSS'huEu uPlt3 ED\EMH MXXXH_^[jh8D33}jY]3u;5}ElE9tV@ uFfxAFwFPYlE4V%YYlE@ t PVrYYF듋bj8h<Y lElE9tFh PFYYlEu47YlE PX1DlE<};tg ___OE Ë}jYSVWT$D$L$URPQQh8qCd5@D3ĉD$d%D$0XL$,3p t;T$4t;v.4v\ H {uhCmCmd_^[ËL$At3D$H3Uhp pp> ]D$T$UL$)qqq( ]UVWS33333[_^]Ëjm33333USVWjjhqCQ_^[]Ul$RQt$ ]UQVu VE F Yu N -@t |"S3ۨt^NF F f F ^]u, ;t w@;u u mYuVaYfF WF>HN+I;N~WPu J EM F yM ttk8kEpD@ tjSSQ\l#ƒt%FM3GWEPu J E9}t N E%_[^A @tyt$Ix  QPzYYu UVMEM >t} ^]U$x@D3ʼnSV3W MEЉ}ԉuuuuuĉuuy9uu-VVVVV*}tE`pE@ @PYt6uYt(uu4kEk8YY3pD@$uutYt6ufYt(uXu4kEFk8YY3pD@$";3Ʉ҉ủu؉uUC}], t-tHHt9M0M'MMM *u }ԋ;}M]Ek ʍDЉEu*u}ԋ;}MEk ʍDЉEItFht8ltwxMl;luCM]WMNM E<6u{4uCCM](<3u{2uCCe] 9E~E}~-u]V2UYEt E܉uE3EGEEPuu}PuESP5DgYЋ}t9uuEPS5DAYYY}gu;uEPS5D"YYY;-u MC]SrEM!spHHYE'EEEQE0EEf t@}tGG@Gt3҉}@t;|;s؃ځMfEڋu3ۃ}} Ee9E~E u!EčEM t$EؙRPSW409]~MN̍+FfEE؉utLt΀90tAM܋M0@2If90t@@;u+E;uDE܋EI8t@;u+E܉E؃}E@t%ftE-tE+t E E]+]+]E uuЍESj uċ}ЍE̍M\fEYtEuWSj0EX }EtQ~Mu܉EMPjPEFPFeu9EtuE̍e}YuM MPEeY}|EtWSj E }t ureY]Et$M}Ԋ)3PPPPP$}tE`pE̋_^3[tvC[uCvuCuCuCvC>vC6wCU S39]u WSSSSSVu W};t!;u'SSSSSj;Ew}uEuEBuuPuU;Et4;|"MxEEPS YYtE39]\>HH_^[UQS39]u SSSSS 9]VuWu;u9] u3;t} ;wJ:;}uuuv-8E@PVhCuL 8"ue8\WVhCE\>u}u8"u/M#;}"u"SSSSSG_^[Vt$VPeaYYt{ ;u3@;u_3@D\EfF uNSW^^N _3[@^3^Ã|$t'Vt$ fF tVf f&fY^USuMm]C=wE苀Xu]}EPE%PG%YYtEjE]EY 3Ɉ]EAEjppEPQEPEjP%E u8EtE`p3E#E }tMap[UVWuM mEu 3;t0;u,WWWWW}tE`p39}t }|Ƀ}$ËMS}~~EPjPM BtGǀ-uM+uGEI@$7u*0t E 4t }w u,9uv'XE"tME$ƉEEt8Et]}tE`pEEt0}tE`p3[_^U39lTEPuu uuhDP]U8SWuMjE} 3;t8;u-SSSSS38]tEЃ`p33>9]t }|ȃ}$Vuȉ]]GE~EPEjPjuȃ EA;uĀ}-}uM}+u G}E9]jYu%}0t E 59ur9w}v1衾E"t MMEt e]MuE^tMEtEM؃ىEM}tEЃ`pEU_[U39lTEPuu uuhDPH]U}uu }MfofoNfoV fo^0ffOfW f_0fof@fonPfov`fo~pfg@foPfw`fpIuu}]U}u]] ÙȋE3+ʃ3+ʙ3+3+ uJu΃M;t+VSP' EMtw]U +щU+ى]u}MES;u5كMu }MMMU UE+EPRQL Eu }MʃE]u}]U$@D3ʼnEEM SVuWP3WWWWQEPEPM3o Et }}0EPEPeEYYuuEuuE+EMFEFEF_^3[riU|@D3ʼnEES3V3EE F39]$WE}]u]]]]]]]u費SSSSSC3UU< t < t< t< uB0B /$@CȀ1wjYJ݋M$ :ujY+tHHt jYE뢃ejY뙊Ȁ1uvM$ :uj<+t(<-t$:t=u Fd.=u Fd=u Fd=uFdvdjY~d`QӋEYF`[_^VW3t$ CYu'9h\EvV0D;h\Evuɋ_^VW3jt$t$Q u'9h\EvV0D;h\Evu_^VW3t$t$pYYu-9D$t'9h\EvV0D;h\Evu_^VW3t$t$t$r u-9D$t'9h\EvV0D;h\Evu_^UUVujX;EUu S3;|;5kEr'ޕĕSSSSS URƃk8W@M}ED% u$L& t9]t@MED& SMQuP41D|M;q;MhMD};t M9 u ]E;؉]EM<< t CAMEH;sA8 u AAM uEmEjEPjEP41Du 1DuE}t?DHt} t ML%;]u} tjjjuP.} t CE9EGD@uC+E}EK xC3@;]rK @hDthDu 腒*zA;u@AHt$CQ| T%Cu T&C+ؙjRPuv-E+]Pu Sujh0DEu41DP*YME;E tP=YEEE3;EL0;tMf9 u ]E;؉]EEff tf CC@@EM;s!Hf9 uEf MEjEPjEP41Du 1DuZ}tTDHt'f} tf MLML%D& );]uf} tjjju,f} tf CCE9Et@uffCC+]]1Dj^;u} 腐0hmX][3_[^jhDEuM 2 3;|;kEr!$8 WWWWW蛏ɋkEk8 L1t;MAu֏8輏PY}D0tuu u E膏 莏8ME EFuYUVuW3;u3e9}u:j^0WWWWW̎E9}t9u rVuuK u Wum> 9}t9u sj"YjX_^]QSUVW58}EY54}Et$H;YY+ލkrxV';YsJ;s;rPt$YYuF;rCPt$YYt3P=Yt/jUl;YYtJVUPO t SSSSS8u5DTE/DTE0}E3Y]_^[5 TE/ TEUQMS39EVU t ]EE>"u39E"FE<tBU PFJYt} t M E FۋU Mt2}u t utBe>< t< uFN>}t EE3C3FA>\t>"u&u}t F8"u 339EEtIt\BuU tU}u< tK< tGt=Pt#JYt M E FM E  IYtFU FVtBU ME^[t U S39<}EVWuvh\EVS]E(1D,}E;É50TEt8EuuUEPSS}E =?sJMsB;r6P;Yt)UEPWV}E HTE5TE3_^[QQ]ESUVW=41D33;j]u-׋;t ]E"1Dxu ţ]E]E;u׋;u3f9tf9uf9u=0DSSS+S@PVSSD$4׋;t2U;YD$t#SSUPt$$VSSׅut$,Y\$\$Vl0DX;t;up0D;p8t @8u@8u+@Ul;Yu Vt0DDUVWX= Vt0D_^][YYU@DeeSWN@;ǻt t УDD`VEP1Du3u0D31D32D3EP2DE3E3;uO@ u 5@D։5DD^_[UQQ@D3ʼnE]ESV3;Wu:EP3FVhpDV2Dt5]E41Dxu jX]E]E;9]]u@E50D39] SSuu Pu֋;~<w4D?=w;tP+;Yt ؅ti?PjSS. WSuu juօtuPSu2DES;LEYu39]u@E9]u@EuBYu3G;EtSSMQu PuB;t܉u uuu uu 2D;tV*YǍe_^[M3+UuM(u$Mu uuuuu }tMapVt$v)v)v )v)v)v|)6u)v m)v$e)v(])v,U)v0M)v4E)v=)v85)v<-)@v@")vD)vH)vL )vP)vT(vX(v\(v`(vd(vh(vl(vp(vt(vx(v|(@((({(p(e(Z(O(D(9(.(,^Vt$t5;0DtP(YF;4DtP'Yv;58DtV'Y^Vt$t~F ;uY]j_};=}E}WlE9tD@ tP$YtE|(lE P`1DlE4BYlEGE E7jsYSUVt$F @WV薇;YpDt.V膇Yt"VzVua8*uϰ?袐|$ ^[U$x@D3ʼnSV3W MEЉ}ԉuuuuuĉuu 9uu-`VVVVV`}tE`pE@ @PuYt6uuYt(uuu4kEuk8YY3pD@$uucuYt6uUuYt(uGuu4kE5uk8YY3pD@$";҉ủu؉uuUC39Ẻ]ʀ Xw (DMk HDj^;ƉEjY;z$SC3MEEEEĉEEVƒ t<t++tHHt8 u0M'MMM *u }ԋ}M]Ek ʍDЉEe*u}ԋ}MEk ʍDЉEItFht8ltwwMk;luCM]VMMM D<6u{4uCCM]'<3u{2uCCe] EYtEuWSj0E: }EtQ~Mu܉EMPjPEFPFu9EtuE̍}YuM MPEY}|EtWSj E踇 }t ueY]Et!}Ԋ W3PPPPP39ut }}tE`pE̋_^3[ÐCyCCCC&C]CWCU,EH SفMHMH?WMEu'339\u @|33}૫jXeVu}ԥ5DNNс]EyJB|j3Y+@ME҅T|u@|nƙjY#yNFe+3BL1u19ur"9Ut+eLr;ursEHUMyщMM!E@} jY|+3}tCD+ D;} 3}૫ ;+Euԋȍ}ख़¥yJBeeE )U׋]\3#ωMM u3uE}u|ӋjMZ+;|1tdJ}5DNNсEyJBjY+3B\M҅T|u@|fƙjY#yNFe3+BL1<;r;sE9MtLr3;rs3G1HyދM!E@} jY|+3 DA‹yJBeeE )U׋]\3#ωMM u3uE}u|ӋjMZ+;|1tdJ}j3XZ;D D3}૫M‹yJBeeE )U׋]\3#ωMM u3uE}u|ӋjMZ+;|1tdJ}础D D3@De؋‹yJBeeE )U֋M|#ΉMM }|}ME}}|ЋjMZ+;|1tdJ}3^jY+ DMɁ ً D ]@u M UY uM _[U,EH SفMHMH?WMEu'339\u @|33}૫jXeVu}ԥ5DNNс]EyJB|j3Y+@ME҅T|u@|nƙjY#yNFe+3BL1u19ur"9Ut+eLr;ursEHUMyщMM!E@} jY|+3}tCD+ D;} 3}૫ ;+Euԋȍ}ख़¥yJBeeE )U׋]\3#ωMM u3uE}u|ӋjMZ+;|1tdJ}5DNNсEyJBjY+3B\M҅T|u@|fƙjY#yNFe3+BL1<;r;sE9MtLr3;rs3G1HyދM!E@} jY|+3 DA‹yJBeeE )U׋]\3#ωMM u3uE}u|ӋjMZ+;|1tdJ}j3XZ;D D3}૫M‹yJBeeE )U׋]\3#ωMM u3uE}u|ӋjMZ+;|1tdJ}硘D D3@De؋‹yJBeeE )U֋M|#ΉMM }|}ME}}|ЋjMZ+;|1tdJ}3^jY+ DMɁ ً D ]@u M UY uM _[U@D3ʼnEESV39u WEN@0ppFX}𥥥< ыH Ή}e ˋ] ׍<;0PHr;sE39]8tr;rs3CۉptAHHU3;r;s3FXt@MHe ?< PU މxX4;Ur;sE}0tO3;rs3B҉HtCXM E} 3&HP EH9ptջXu00xE04? H ʅˉpHtfMfH M_^3[_U(@D3ʼnESVuWu} MEP3SSSSWEPEP豎EEVPg(Eu+u8]tE`pjX/u8]tE`pjEuEu8]tE`p3M_^3[U(@D3ʼnESVuWu} MEP3SSSSWEPEP EEVP(Eu+u8]tE`pjX/u8]tE`pjEuEu8]tE`p3M_^3[UMSVu3;Wy uIj^0SSSSSI9] v݋U;ӈ~3@9E wOIj"Y;0F~:tGj0Y@J;M;ӈ|?5| 0H89t>1uA~WG@PWV~3_^[]UQU BSVW%#ωE Bپ%ۉut;t<($3;u;uEfM XL<] ME ΉHuP Ɂ։PtM _^fH[U0@D3ʼnEES]VEWEPEPYYEPjj uf^uЉCE։EԉCEPuV$t3PPPPPWFM_s ^3[ ̀@s sË3Ҁ33j.YUEM %#Vt1W}3;t VVYY5Gj_VVVVV8F_uPu t {rYY3^]UEu3@]@EEPE :E \E 1Dtu3]UQQS39]t7uYu1FFSSSSS .F3XEW} ;t-M;eFSSSSSE3M];t@EE:E.]E.]V51DEPWuEP;te;t;E|XE"Z;E~Eju;YYuE E(EPWuEP;t ;E}1DPEY3^_[j h@D&SjGYeu uj EE E8SjFYj h`DRM3;v.jX3;E @u E WWWWWD3M u;u3F3ۉ]wi=(}EuKu E;}Ew7j7GY}uxOYEE_];tuWS ;uaVj5TE1D;uL9=YEt3VUYrE;P E3u jEY;u E;t RUQeWEPu u uVutCtC0^_j,hDQ3ۉ]ȉ]ԉ]]܉]؉]j4FY]EEPY;t SSSSSFBEP%Y;t SSSSS+BEP>Y;t SSSSSBẺl^E=|D=pDhDYu;t|8txp^E;t!PVSYYIp^E;tPYVA@PūYYp^E;VV@Y@P5p^EԤ ;SSSSShAp^E;t P|Yp^Eh]E 2D;3A l^E]Ek-uEFVYiE<+t<0|<9F3ۋujBYÀ>:u8FVYk<E<9F<0}>:uFVYE<9F<0}9]t]E;t#jVj@wtSSSSSl?Gu0u0NU e} SVW}%yH@Eu jd[ult PD DE +_jd_FjEÙU}+ЋڍGimÍ%[Ek+E;Ut}}u jd[ult E TD E D;~D?%yH@u jd[ult 4PD4Duk<M k<M$iM(}u5tD xD=pDkEP5D DYt3PPPPP=EiDyD\& D\&9D| )DD=|D_^[UQVE3Pu+Yt VVVVV1=9uu32WS3C;pDu ;|D95l^Ef95X^Ef^E `^EPd^EPb^EPu\^EVP^^EPRS ^^EPVVRVZ^ES]^E ^E$f95^EP^EP^EPu^EVP ^EPwS ^EPVVwV^EV$.VVVVVSRSSjYjXVVVVVjwSVjYj XH tDD;ȋW};|";;~;}[^;|;;~;}3Gk<Gk<i;u 3;xD 3;DjhDJ395t^Eu*jR?Yu95t^Eu t^EEJjJ>Yj hDEJj ?Ye}EE E_Jj >YËD$V3;u`\$t6S]&Y%PR&;Yv<8=uWSP tu3_[^ËD83PPjPjh@hD1DDáDV50DttP֡DttP^jhDW539}EtVE@tH9Dt@EU.E=t =t33@Ëe%DeUEeU75USuM;M3;u8]tE`p39]u.'SSSSS&8]tE`p9] tV;v&SSSSSm&?E9XuuQu u6pQu Quhp EP_ ;u8]tE`p8]tMap^[jt$t$t$UQQSV3W=(TEu;te0DVVVVjPVV;ƉEtTjP;YYEtCVVuPj7VVӅt6EVPYY}9ut uYu;u3_^[ÃuYU,@D3ʼnEESVW39=|^Eڋ]܉Eu8jpDPjPWW42Dt |^E1Dxu |^E9}~AMI8t@;u+EU;~,EI8t@;u+ЉU}}3| |^E;3@;u9}}uIM9}t;9UujXu;m9E~jEPu1Dt9}~)}r}Et׊PtЊ :r:v@@8u9}~8}s3@}EtPtM :r:t@@8u΋50DWWuSj u֋;߉]ۿ~@j3Xr4D;wXątPYt Ee}Suuujuօjjuuj u֋؅t{~Bj3Xr6D;w؅tZPYt 3t1SWuujuօtSWuuu u42DEWYuEY339}u@E9}u@EuY;utPjjEPuVu7؃jjEPuVuu SLYk]܉}uuuuu u02DۋtSWYYƍe_^[M3UuMu$Uu Muuuu I}tMapUSuMU3;u8]tE`p39]u.!SSSSSI!8]tE`p9] tV;v{!SSSSS !KEH;uEPRu u?pERu RuhQP ;u!!8]tE`p8]tMap^[V5 TE"WPt$ u <=ttu؋+ TE^Ë+ TE^UQ3u9t @9uSV@jP莉YYuuj YPdYu!E^[UES3;W]u5 SSSSSlV0;utSj=Vz;YYEtB;t>38X TE;$TEMu 4 TE;u`9] t$9(TEtvtJ^_[9]jf;Y TEtމ9(TEujK;Y(TEtÉ5 TE;ut}+}uc;Y|R9tN469]YuEEFEG49u?sjjW5 TE览 ;tUN9];}ߍG;3=?(Pj5 TEk ;U YM TE9] txujV@Y@P蟇;YYt\VV@Y@PWy t SSSSSM+E@#QW<2DuM?*WY9]tuEYEeuEY3PS\$U3;u3=VWSFV;YYt SVW t UUUUUe3_^][%H1DBP`p.,>Rҵd|XB*ʬ&6JVbtڭ 2:P`nʮ֮ &6BRbt\үxfV>&йtfTH>&޸̸vhJ.ܷзķƺҺvĻֻ*:J\nH2Զ¶VtfZF8&ֳʳ³p`:(ܴδN8,ԲvdXH8&ұpbP@.ڰȰxj`R>0²r o   eglstv78C5WCZCC CoCD[C <> W H L %s %s %s %ld rt_ffftp.idx_ffftp.%03d%s.%dFFFTPWinwt!!#!V!W!"!&!r%!%#%%%'%)%c%e%g%C%.\./.: --> Duplicate!!FileList : NODE=%d : %s/p:ma:m...\izXgji[Jj*-+f -> PSPODRLinks:Dirs:Files:.DIR;dl------DIRListType=%d-dDlLt@Cꗗ̎擾Ɏs܂.e|t@Cǂݏo܂.rbRffftp%dLTCYtOSysListView32ILJKPQRS---- END ----REMOTE : %s %s [%s] %sLOCAL : %s %s [%s] %sNO YESFILEDIR %04d/%02d/%02d %02d:%02d:%02d.%04d---- MIRROR FILE LIST ----L-RMD R-RMD 폜t@C^tH_͂܂.%d‚̃t@C^tH_폜܂.쐬tH_͂܂.%d‚̃tH_쐬܂.]t@C͂܂.%d‚̃t@C]܂.RETRSTORL-MKDR-MKDL-RMDL-DELER-RMDR-DELEOύXă_E[hOύXăAbv[h폜izXgj폜i[JjOύXizXgjOύXi[JjtH_쐬izXgjtH_쐬i[JjtH_ύXizXgjtH_ύXi[JjzXg̃t@CeʂvZ܂B[J̃t@CeʂvZ܂BzXg̃t@Ce[J̃t@Ce폜F %s]F %s쐬F %s%03Xftp://%s%s/%s ftp://%s%s%s :%dCWD %sGOQUITBACKCURRETR ')(MKD SETCURRETR-S L-MKD L-DELE STOR R-MKD R-DELE TransList Cmd=%s : %s : %sTransList Cmd=%sMKDTransList Cmd=%s : %sL-R-~ ??:?? %d:%02d( %s.%02d KB/S )( %s B/S )( 0 B/S )%sk / %sk %s / %s %d (%d)%sEUCJISϊAXL[oCiAUX.PRN.CON.AUXPRNCON_E[h%s ͕sȃt@CłB ̃t@C̓_E[h܂B/../\..\../..\fBXNςŏ߂܂.ABORshutdownt@C %s 쐬ł܂.recvM̓^CAEgŎs܂.ǂݎpt@CłBǂݎp܂HREST %st@C %s I[vł܂.Abv[h͐I܂.Abv[h͐I܂. (%d Sec. %d B/S).Abv[h𒆎~܂.Abv[h𒆎~܂. (%d Sec. %d B/S).t@Cꗗ̎擾͐I܂. (%d Bytes)_E[h͐I܂. (%d Bytes)_E[h͐I܂. (%d Sec. %d B/S).t@Cꗗt@Cꗗ̎擾𒆎~܂._E[h𒆎~܂._E[h𒆎~܂. (%d Sec. %d B/S).LISTNLSTListen\Pbg擾ł܂R}h󂯕t܂.Skt=%u : accept from %s port %uacceptData\Pbg擾ł܂shutdown listenAPPE %s%sAhX擾ł܂.PASV[hŐڑł܂Abv[ĥ߂PASV_E[ĥ߂t@C %s ̓XLbv܂.XLbvt@C %s ǂݏo܂.%s %03X %sAbv[hSTOU TYPE %ct@Cꗗ擾%sƂÕt@C̓_E[hł܂.t@C폜tH_폜%s %03d %sMKD %stH_쐬RETR-S&* %s (%s) %s&0 %s (%s) %s&%d %s (%s) %s$"#&'()+*-alLSITE CHMODOTP SHA-1OTP MD5OTP MD4, S/KEYFgpȂGMT%+02d:00GMT%+02d:00 ({)GMT%dVo\N WLAgilent Logic analyzerStratusACOS-4IRMXVAX VMSACOSFIREWALL=PASVMODE=DIR=LOCDIR=UID=HOST=[_config_] WS_FTP.INIt@CWS_FTP.INIws_ftp.iniSĂ̧*WS_FTP.INIzXg̐ݒx_CAAbvR[hg{tH_ύXł܂.>>CD %stH_쐬ł܂.>>MKDIR %stH_폜ł܂.>>RMDIR %st@C폜ł܂.>>DEL %st@CύXł܂.>>REN %s %sPropertiesXTitleTipFFFTPWin>>%sr[̋NɎs܂. (ERROR=%d)FindExecutable - %s%s "%s"ShellExecute - %s%s "%s" "%s"%s %s %shttp://www2.biglobe.ne.jp/~sota/JRE32.DLL Ver %x.%x (C) RcavJRE32.DLL FFFTP (%s)%s (%s) - FFFTPzXgƐݒ薼̗w肳Ă܂.ݒ薼w肳Ă܂.ݒ薼u%sv͂܂.IvVu%svԈĂ܂.INIt@Cw肳Ă܂-helph-sets-saveon-saveoff-inin-jisnamei-eucnameu-kanak-quitq-forcef-autox-binaryb-asciia-jisj-euce-mirrordownd-mirrormremote.d ݒt@C畜邽߂ɂ́AFFFTPċNĂBFFFTPhttp://www2.biglobe.ne.jp/~sota/ffftp-qa.htmlM~tH_ړpJiSpɕϊR[h̕ϊȂzXg̊R[hJISzXg̊R[hEUCڍꗗ\XVt@Cœ][hؑւoCi][hAXL[][htH_̈ړ̃tH_OύX폜~[OAbv[hؒfNCbNڑڑHelp=%sTmp =%stH_u%svgp܂e|tH_u%sv܂INIt@CwFFFFTP Ver.1.96d Copyright(C) 1997-2008 Sota.DEBUG MESSAGE ON ! ##ffftp.iniffftp.chmFFFTP - StartupOLȄɎs܂B%.0f Bytes%.2fK BytesP?@%.2fM Bytes>0A %2d:%02d %04d/%02d/%02d ---------tH_IĂ:\// XAIIHJ78  OTP MD4,S/KEY%cUSER FW[U:FWpX[h@zXgSOCKS5 ([UApX[hF)SOCKS5 (F؂Ȃ)SOCKS4OPEN zXgUSER [U@zXgFW[U FWpX[hFW[U FWpX[h USER [U@zXgFW[U FWpX[h SITE zXgr[̑Ist@C*.exe;*.com;*.batSĂ̧*Wavet@CWavet@C*.wavSẴt@C*t@C%03dIvV̑TEhc[FireWallڑ/ؒf\~[O]R]Q]P[URasDialDlgArasdlg.dllRasGetErrorStringARasGetConnectStatusARasGetEntryDialParamsARasDialARasHangUpARasEnumEntriesARasEnumConnectionsArasapi32.dll_CAAbvؒfĂ܂.ڑ...ڑ܂؂I܂pX[hύXĉČؒ...[UƃpX[hؒ...SfoCXڑ܂_CA_CA...|[gJ܂|[gJĂ܂...%s ւ̐ڑ%s ɐڑĂ܂..._CAAbvڑsȃG[_CAAbvg܂(RasDialDlg)_CAAbvŐڑĂ܂.GetJreMessageJreGetVersionJre2CloseJre2GetMatchInfoJre2CompileJre2Openjre32.dllanonymous FTP siteVectorftp.vector.co.jp̓m(Forest)ftp.forest.impress.co.jpRing serverftp.ring.gr.jpBIGLOBEftp.biglobe.ne.jpIIJftp.iij.ad.jpSUNSITEsunsite.sut.ac.jpWIN Internet Serviceftp.win.ne.jpMicrosoftftp.microsoft.comNoDrivesExplorerPoliciesCurrentVersionWindowsMicrosoftSoftwareHistory%dHost%dOptionsSoftware\SotaINIt@C*.iniSẴt@C*iniFFFTP-Backup.iniWXgGfB^Nł܂łregedit/e "%s" HKEY_CURRENT_USER\Software\sota\FFFTPݒt@C̕ۑRegt@C*.regSẴt@C*regFFFTP.regݒt@C͊gq.reg.iniłȂ΂Ȃ܂B.ini"%s".regݒt@C畜Regt@C*.regINIt@C*.iniSẴt@C*%d %d %d %d %d %d %d %d %d %d %d %d %d %s%d %d %d %d %d %d %d %d %d %d %d %d %dSoftware\Sota\INIt@Cɐݒ肪ۑł܂%s [%s] # ̃t@C͕ҏWȂłB =\%02X%02xCurSetBmarksLastAnonymousHostNameSetSetNumDialToNotifyUseItDialPasswordSecuSortFpathSyncTypeTzoneNLST-RListFwallPasvNameKanaNameKanjiKanaCnvKanjiPortInitNlstChmodRemoteDirLocalDirAccountUserNameHostAdrsSavedHistHistNumNoSaveFAttrFAttrSwMdlgBdlgHdlgTmpDefAttrSndErrSndTrnSndConSndErrSwSndTrnSwSndConSwFwallDelFwallLowFwallResPasvDefFwallSecFwallDefFwallTypeFwallPortFwallPassFwallUserFwallHostListDrvListHideListFontMirDNotMirUNotMirFileNoDelNoTrnToutLowUp*.AsciiAsciiFileRegRegExpWinPosDebugNoRasSendQuitPassHistQanonyRasNotifyRasCloseOldDlgConSDclickDotFileCacheSaveCacheListTypeSortSaveRDsortRFsortLDsortLFsortSendExRecvExScolonEOFTimePathMoveSendRecvTrTypeViewer3Viewer2ViewerUserMailSwCmdRemoteColmLocalColmTaskHeightLocalWidthWinHeightWinWidthWinPosYWinPosXVersionHistSkt=%u : Socket closed. -Œ蒷̎Ms܂Non-authoritive: host not found or server failureNon-recoverable: refused or not implementedValid name, no data record for typeerror %uAuthoritive: Host not foundaddress not availablehost unreachablehost downconnection refusedconnection timed outnot connectedconnection resetconnection abortedaddress already in usesocket marked as non-blocking and SO_LINGER set not 0descriptor is not a socketsocket type not supported for address familyprotocol wrong type for this socketspecified protocol not supportedno buffer space availableno file descriptors availableaddress family not supportedBlocking call cancelledBlocking operation in progressNetwork subsystem failedWSA Startup not initializedapp version not supported by DLLWinSock not present or not respondingversion of WinSock not supported[[%s]][[%s : %s]]sendM̓^CAEgŎs܂. >%sOPEN USER >PASS [xxxxxx]PASS QUITPWDXPWDRMD %sDELE %sRNTO %sRNFR %sSIZE %s%04d%02d%02d%02d%02d%02dMDTM %sCWD [.%s]CDUPAABEACEACTADADAADDAGOAIDAIMAIRALLALPAMAMYANANAANDANNANTANYAPEAPSAPTARCAREARKARMARTASASHASKATATEAUGAUKAVEAWEAWKAWLAWNAXAYEBADBAGBAHBAMBANBARBATBAYBEBEDBEEBEGBENBETBEYBIBBIDBIGBINBITBOBBOGBONBOOBOPBOWBOYBUBBUDBUGBUMBUNBUSBUTBUYBYBYECABCALCAMCANCAPCARCATCAWCODCOGCOLCONCOOCOPCOTCOWCOYCRYCUBCUECUPCURCUTDABDADDAMDANDARDAYDEEDELDENDESDEWDIDDIEDIGDINDIPDODOEDOGDONDOTDOWDRYDUBDUDDUEDUGDUNEAREATEDEELEGGEGOELIELKELMELYEMENDESTETCEVAEVEEWEEYEFADFANFARFATFAYFEDFEEFEWFIBFIGFINFIRFITFLOFLYFOEFOGFORFRYFUMFUNFURGABGADGAGGALGAMGAPGASGAYGEEGELGEMGETGIGGILGINGOGOTGUMGUNGUSGUTGUYGYMGYPHAHADHALHAMHANHAPHASHATHAWHAYHEHEMHENHERHEWHEYHIHIDHIMHIPHISHITHOHOBHOCHOEHOGHOPHOTHOWHUBHUEHUGHUHHUMHUTIICYIDAIFIKEILLINKINNIOIONIQIRAIREIRKISITITSIVYJABJAGJAMJANJARJAWJAYJETJIGJIMJOJOBJOEJOGJOTJOYJUGJUTKAYKEGKENKEYKIDKIMKINKITLALABLACLADLAGLAMLAPLAWLAYLEALEDLEELEGLENLEOLETLEWLIDLIELINLIPLITLOLOBLOGLOPLOSLOTLOULOWLOYLUGLYEMAMACMADMAEMANMAOMAPMATMAWMAYMEMEGMELMENMETMEWMIDMINMITMOBMODMOEMOOMOPMOSMOTMOWMUDMUGMUMMYNABNAGNANNAPNATNAYNENEDNEENETNEWNIBNILNIPNITNONOBNODNONNORNOTNOVNOWNUNUNNUTOOAFOAKOAROATODDODEOFOFFOFTOHOILOKOLDONONEORORBOREORROSOTTOUROUTOVAOWOWEOWLOWNOXPAPADPALPAMPANPAPPARPATPAWPAYPEAPEGPENPEPPERPETPEWPHIPIPIEPINPITPLYPOPODPOEPOPPOTPOWPROPRYPUBPUGPUNPUPPUTQUORAGRAMRANRAPRATRAWRAYREBREDREPRETRIBRIDRIGRIMRIORIPROBRODROERONROTROWROYRUBRUERUGRUMRUNRYESACSADSAGSALSAMSANSAPSATSAWSAYSEASECSEESENSETSEWSHESHYSINSIPSIRSISSITSKISKYSLYSOSOBSODSONSOPSOWSOYSPASPYSUBSUDSUESUMSUNSUPTABTADTAGTANTAPTARTEATEDTEETENTHETHYTICTIETIMTINTIPTOTOETOGTOMTONTOOTOPTOWTOYTRYTUBTUGTUMTUNTWOUNUPUSUSEVANVATVETVIEWADWAGWARWASWAYWEWEBWEDWEEWETWHOWHYWINWITWOKWONWOOWOWWRYWUYAMYAPYAWYEYEAYESYETYOUABEDABELABETABLEABUTACHEACIDACMEACREACTAACTSADAMADDSADENAFARAFROAGEEAHEMAHOYAIDAAIDEAIDSAIRYAJARAKINALANALECALGAALIAALLYALMAALOEALSOALTOALUMALVAAMENAMESAMIDAMMOAMOKAMOSAMRAANDYANEWANNAANNEANTEANTIAQUAARABARCHAREAARGOARIDARMYARTSARTYASIAASKSATOMAUNTAURAAUTOAVERAVIDAVISAVONAVOWAWAYAWRYBABEBABYBACHBACKBADEBAILBAITBAKEBALDBALEBALIBALKBALLBALMBANDBANEBANGBANKBARBBARDBAREBARKBARNBARRBASEBASHBASKBASSBATEBATHBAWDBAWLBEADBEAKBEAMBEANBEARBEATBEAUBECKBEEFBEENBEERBEETBELABELLBELTBENDBENTBERGBERNBERTBESSBESTBETABETHBHOYBIASBIDEBIENBILEBILKBILLBINDBINGBIRDBITEBITSBLABBLATBLEDBLEWBLOBBLOCBLOTBLOWBLUEBLUMBLURBOARBOATBOCABOCKBODEBODYBOGYBOHRBOILBOLDBOLOBOLTBOMBBONABONDBONEBONGBONNBONYBOOKBOOMBOONBOOTBOREBORGBORNBOSEBOSSBOTHBOUTBOWLBOYDBRADBRAEBRAGBRANBRAYBREDBREWBRIGBRIMBROWBUCKBUDDBUFFBULBBULKBULLBUNKBUNTBUOYBURGBURLBURNBURRBURTBURYBUSHBUSSBUSTBUSYBYTECADYCAFECAGECAINCAKECALFCALLCALMCAMECANECANTCARDCARECARLCARRCARTCASECASHCASKCASTCAVECEILCELLCENTCERNCHADCHARCHATCHAWCHEFCHENCHEWCHICCHINCHOUCHOWCHUBCHUGCHUMCITECITYCLADCLAMCLANCLAWCLAYCLODCLOGCLOTCLUBCLUECOALCOATCOCACOCKCOCOCODACODECODYCOEDCOILCOINCOKECOLACOLDCOLTCOMACOMBCOMECOOKCOOLCOONCOOTCORDCORECORKCORNCOSTCOVECOWLCRABCRAGCRAMCRAYCREWCRIBCROWCRUDCUBACUBECUFFCULLCULTCUNYCURBCURDCURECURLCURTCUTSDADEDALEDAMEDANADANEDANGDANKDAREDARKDARNDARTDASHDATADATEDAVEDAVYDAWNDAYSDEADDEAFDEALDEANDEARDEBTDECKDEEDDEEMDEERDEFTDEFYDELLDENTDENYDESKDIALDICEDIEDDIETDIMEDINEDINGDINTDIREDIRTDISCDISHDISKDIVEDOCKDOESDOLEDOLLDOLTDOMEDONEDOOMDOORDORADOSEDOTEDOUGDOURDOVEDOWNDRABDRAGDRAMDRAWDREWDRUBDRUGDRUMDUALDUCKDUCTDUELDUETDUKEDULLDUMBDUNEDUNKDUSKDUSTDUTYEACHEARLEARNEASEEASTEASYEBENECHOEDDYEDENEDGEEDGYEDITEDNAEGANELANELBAELLAELSEEMILEMITEMMAENDSERICEROSEVENEVEREVILEYEDFACEFACTFADEFAILFAINFAIRFAKEFALLFAMEFANGFARMFASTFATEFAWNFEARFEATFEEDFEELFEETFELLFELTFENDFERNFESTFEUDFIEFFIGSFILEFILLFILMFINDFINEFINKFIREFIRMFISHFISKFISTFITSFIVEFLAGFLAKFLAMFLATFLAWFLEAFLEDFLEWFLITFLOCFLOGFLOWFLUBFLUEFOALFOAMFOGYFOILFOLDFOLKFONDFONTFOODFOOLFOOTFORDFOREFORKFORMFORTFOSSFOULFOURFOWLFRAUFRAYFREDFREEFRETFREYFROGFROMFUELFULLFUMEFUNDFUNKFURYFUSEFUSSGAFFGAGEGAILGAINGAITGALAGALEGALLGALTGAMEGANGGARBGARYGASHGATEGAULGAURGAVEGAWKGEARGELDGENEGENTGERMGETSGIBEGIFTGILDGILLGILTGINAGIRDGIRLGISTGIVEGLADGLEEGLENGLIBGLOBGLOMGLOWGLUEGLUMGLUTGOADGOALGOATGOERGOESGOLDGOLFGONEGONGGOODGOOFGOREGORYGOSHGOUTGOWNGRABGRADGRAYGREGGREWGREYGRIDGRIMGRINGRITGROWGRUBGULFGULLGUNKGURUGUSHGUSTGWENGWYNHAAGHAASHACKHAILHAIRHALEHALFHALLHALOHALTHANDHANGHANKHANSHARDHARKHARMHARTHASHHASTHATEHATHHAULHAVEHAWKHAYSHEADHEALHEARHEATHEBEHECKHEEDHEELHEFTHELDHELLHELMHERBHERDHEREHEROHERSHESSHEWNHICKHIDEHIGHHIKEHILLHILTHINDHINTHIREHISSHIVEHOBOHOCKHOFFHOLDHOLEHOLMHOLTHOMEHONEHONKHOODHOOFHOOKHOOTHORNHOSEHOSTHOURHOVEHOWEHOWLHOYTHUCKHUEDHUFFHUGEHUGHHUGOHULKHULLHUNKHUNTHURDHURLHURTHUSHHYDEHYMNIBISICONIDEAIDLEIFFYINCAINCHINTOIONSIOTAIOWAIRISIRMAIRONISLEITCHITEMIVANJACKJADEJAILJAKEJANEJAVAJEANJEFFJERKJESSJESTJIBEJILLJILTJIVEJOANJOBSJOCKJOELJOEYJOHNJOINJOKEJOLTJOVEJUDDJUDEJUDOJUDYJUJUJUKEJULYJUNEJUNKJUNOJURYJUSTJUTEKAHNKALEKANEKANTKARLKATEKEELKEENKENOKENTKERNKERRKEYSKICKKILLKINDKINGKIRKKISSKITEKLANKNEEKNEWKNITKNOBKNOTKNOWKOCHKONGKUDOKURDKURTKYLELACELACKLACYLADYLAIDLAINLAIRLAKELAMBLAMELANDLANELANGLARDLARKLASSLASTLATELAUDLAVALAWNLAWSLAYSLEADLEAFLEAKLEANLEARLEEKLEERLEFTLENDLENSLENTLEONLESKLESSLESTLETSLIARLICELICKLIEDLIENLIESLIEULIFELIFTLIKELILALILTLILYLIMALIMBLIMELINDLINELINKLINTLIONLISALISTLIVELOADLOAFLOAMLOANLOCKLOFTLOGELOISLOLALONELONGLOOKLOONLOOTLORDLORELOSELOSSLOSTLOUDLOVELOWELUCKLUCYLUGELUKELULULUNDLUNGLURALURELURKLUSHLUSTLYLELYNNLYONLYRAMACEMADEMAGIMAIDMAILMAINMAKEMALEMALIMALLMALTMANAMANNMANYMARCMAREMARKMARSMARTMARYMASHMASKMASSMASTMATEMATHMAULMAYOMEADMEALMEANMEATMEEKMEETMELDMELTMEMOMENDMENUMERTMESHMESSMICEMIKEMILDMILEMILKMILLMILTMIMIMINDMINEMINIMINKMINTMIREMISSMISTMITEMITTMOANMOATMOCKMODEMOLDMOLEMOLLMOLTMONAMONKMONTMOODMOONMOORMOOTMOREMORNMORTMOSSMOSTMOTHMOVEMUCHMUCKMUDDMUFFMULEMULLMURKMUSHMUSTMUTEMUTTMYRAMYTHNAGYNAILNAIRNAMENARYNASHNAVENAVYNEALNEARNEATNECKNEEDNEILNELLNEONNERONESSNESTNEWSNEWTNIBSNICENICKNILENINANINENOAHNODENOELNOLLNONENOOKNOONNORMNOSENOTENOUNNOVANUDENULLNUMBOATHOBEYOBOEODINOHIOOILYOINTOKAYOLAFOLDYOLGAOLINOMANOMENOMITONCEONESONLYONTOONUSORALORGYOSLOOTISOTTOOUCHOUSTOUTSOVALOVENOVEROWLYOWNSQUADQUITQUODRACERACKRACYRAFTRAGERAIDRAILRAINRAKERANKRANTRARERASHRATERAVERAYSREADREALREAMREARRECKREEDREEFREEKREELREIDREINRENARENDRENTRESTRICERICHRICKRIDERIFTRILLRIMERINGRINKRISERISKRITEROADROAMROARROBEROCKRODEROILROLLROMEROODROOFROOKROOMROOTROSAROSEROSSROSYROTHROUTROVEROWEROWSRUBERUBYRUDERUDYRUINRULERUNGRUNSRUNTRUSERUSHRUSKRUSSRUSTRUTHSACKSAFESAGESAIDSAILSALESALKSALTSAMESANDSANESANGSANKSARASAULSAVESAYSSCANSCARSCATSCOTSEALSEAMSEARSEATSEEDSEEKSEEMSEENSEESSELFSELLSENDSENTSETSSEWNSHAGSHAMSHAWSHAYSHEDSHIMSHINSHODSHOESHOTSHOWSHUNSHUTSICKSIDESIFTSIGHSIGNSILKSILLSILOSILTSINESINGSINKSIRESITESITSSITUSKATSKEWSKIDSKIMSKINSKITSLABSLAMSLATSLAYSLEDSLEWSLIDSLIMSLITSLOBSLOGSLOTSLOWSLUGSLUMSLURSMOGSMUGSNAGSNOBSNOWSNUBSNUGSOAKSOARSOCKSODASOFASOFTSOILSOLDSOMESONGSOONSOOTSORESORTSOULSOURSOWNSTABSTAGSTANSTARSTAYSTEMSTEWSTIRSTOWSTUBSTUNSUCHSUDSSUITSULKSUMSSUNGSUNKSURESURFSWABSWAGSWAMSWANSWATSWAYSWIMSWUMTACKTACTTAILTAKETALETALKTALLTANKTASKTATETAUTTEALTEAMTEARTECHTEEMTEENTEETTELLTENDTENTTERMTERNTESSTESTTHANTHATTHEETHEMTHENTHEYTHINTHISTHUDTHUGTICKTIDETIDYTIEDTIERTILETILLTILTTIMETINATINETINTTINYTIRETOADTOGOTOILTOLDTOLLTONETONGTONYTOOKTOOLTOOTTORETORNTOTETOURTOUTTOWNTRAGTRAMTRAYTREETREKTRIGTRIMTRIOTRODTROTTROYTRUETUBATUBETUCKTUFTTUNATUNETUNGTURFTURNTUSKTWIGTWINTWITULANUNITURGEUSEDUSERUSESUTAHVAILVAINVALEVARYVASEVASTVEALVEDAVEILVEINVENDVENTVERBVERYVETOVICEVIEWVINEVISEVOIDVOLTVOTEWACKWADEWAGEWAILWAITWAKEWALEWALKWALLWALTWANDWANEWANGWANTWARDWARMWARNWARTWASHWASTWATSWATTWAVEWAVYWAYSWEAKWEALWEANWEARWEEDWEEKWEIRWELDWELLWELTWENTWEREWERTWESTWHAMWHATWHEEWHENWHETWHOAWHOMWICKWIFEWILDWILLWINDWINEWINGWINKWINOWIREWISEWISHWITHWOLFWONTWOODWOOLWORDWOREWORKWORMWORNWOVEWRITWYNNYALEYANGYANKYARDYARNYAWLYAWNYEAHYEARYELLYOGAYOKEFFFTPSocketWndAskAsyncDone called with unregisterd socket.FFFTP inner errorAskAsyncDoneDbase called with unregisterd handle.No more async regist space.Async socket already registerd.No more async dbase regist space.Async handle already registerd.#### Connect: AsyncSelect error (%d)#### Connect: Error=%ddo_recv timed outdo_write timed outmsctls_statusbar32zXg[JI%di%sj[J %s]҂t@C%dM %sEDITwb_ffftp.tsk## %sErrFV[PXԍErrFV[hCbDxAIJœKLaMijstqrfg]v_NݜhٜOQReklmFdEcĜŜƜǜȜɜʜ˜̜͜ΜϜМќҜӜԜ՜֜ל%sŊJ(&%d)J(&O)COMBOBOXlr oSVbNŐV̏ɍXV(&F)t@CeʌvZ(&Z)tH_쐬(&K)...OύX(&N)...폜(&R)SĂAbv[hOςăAbv[h(&P)...Abv[h(&U)URLNbv{[hփRs[(&C)ύX(&A)...SĂ_E[ht@CƂă_E[h(&I)Oςă_E[h(&W)..._E[h(&D)DistinctNameBuildDisplayHostInfoURLhttp://www2.biglobe.ne.jp/~sota/product/update.infAuthor]csota@mwa.biglobe.ne.jpSoftware\Upcheck????????.???*.*hhctrl.ocxCLSID\{ADB880A6-D8FF-11CF-9377-00AA003B7A11}\InprocServer32!F"FFFFC$C$C./\?*CorExitProcessmscoree.dll  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~.mixcrtEncodePointerKERNEL32.DLLDecodePointerFlsFreeFlsSetValueFlsGetValueFlsAllocruntime error TLOSS error SING error DOMAIN error R6034 An application has made an attempt to load the C runtime library incorrectly. Please contact the application's support team for more information. R6033 - Attempt to use MSIL code from this assembly during native code initialization This indicates a bug in your application. It is most likely the result of calling an MSIL-compiled (/clr) function from a native constructor or from DllMain. R6032 - not enough space for locale information R6031 - Attempt to initialize the CRT more than once. This indicates a bug in your application. R6030 - CRT not initialized R6028 - unable to initialize heap R6027 - not enough space for lowio initialization R6026 - not enough space for stdio initialization R6025 - pure virtual function call R6024 - not enough space for _onexit/atexit table R6019 - unable to open console device R6018 - unexpected heap error R6017 - unexpected multithread lock error R6016 - not enough space for thread data This application has requested the Runtime to terminate it in an unusual way. Please contact the application's support team for more information. R6009 - not enough space for environment R6008 - not enough space for arguments R6002 - floating point support not loaded Microsoft Visual C++ Runtime Library ...Runtime Error! Program: YExYEccs=UTF-8UTF-16LEUNICODE(null)(null)EEE50P( 8PX700WP `h````xpxxxxe+000~PAGAIsProcessorFeaturePresentKERNEL32.com.bat.cmd.exeInitializeCriticalSectionAndSpinCount ((((( H h(((( H H  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~HH:mm:ssdddd, MMMM dd, yyyyMM/dd/yyPMAMDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJanSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunGetProcessWindowStationGetUserObjectInformationAGetLastActivePopupGetActiveWindowMessageBoxAUSER32.DLLEEE00P('8PW700PP (`h`hhhxppwppTZSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec1#QNAN1#INF1#IND1#SNANCONOUT$H@D`DQ8qBTBBBBB;C#C#C'*C,C?/Cu1Cy1C;1CO1C>4C7CO;C>C?C?CFCYCZCZClClCpCCͩCCCPCCsCwCQChC(CxCCCCCC_CCC^C^CnDD7DD6D3d 03D"l0HLp2 H0 80ا0jD24BP`p.,>Rҵd|XB*ʬ&6JVbtڭ 2:P`nʮ֮ &6BRbt\үxfV>&йtfTH>&޸̸vhJ.ܷзķƺҺvĻֻ*:J\nH2Զ¶VtfZF8&ֳʳ³p`:(ܴδN8,ԲvdXH8&ұpbP@.ڰȰxj`R>0²r o   eglstvWSOCK32.dllgImageList_LoadImageAPropertySheetATImageList_DestroyCreateToolbarExCOMCTL32.dllsndPlaySoundAtimeBeginPeriodWINMM.dllGlobalUnlockGlobalLockGlobalAllocWideCharToMultiByteMultiByteToWideCharMFreeLibrary"GetProcAddressLoadLibraryAzGetVersionExAGetDiskFreeSpaceAlstrcpyAlstrlenARCompareFileTimeFindClose4SystemTimeToFileTimeFileTimeToSystemTimeGetLocalTimeGetLogicalDriveStringsASetCurrentDirectoryAGetCurrentDirectoryAFindFirstFileAGetFileAttributesA+SleepGetCurrentProcessId^GetTempPathAGlobalFreeFileTimeToLocalFileTime}ReleaseMutexDCloseHandlenWaitForSingleObjectSetFileTimeWriteFileSetFilePointeryCreateFileASetFileAttributesAnReadFileGetFileSizeCreateMutexAMoveFileA/FindNextFileAGetLastErrorCreateProcessADeleteFileAGetModuleFileNameALocalFileTimeToFileTimeaCopyFileACreateSemaphoreAReleaseSemaphoreWriteConsoleA>GetStdHandleExpandEnvironmentStringsAKERNEL32.dllDeleteMenuBGetMenuItemCountkGetSubMenu<GetMenu AppendMenuADGetMenuItemInfoAySetFocusGetDlgItemYSendDlgItemMessageAEndDialogDialogBoxParamAPostMessageA GetClassNameAEnumWindowsGCloseClipboardmSetClipboardDataEmptyClipboardOpenClipboardInvalidateRectMoveWindow GetClientRectTScreenToClientGetWindowRectDestroyWindowSetTimerDispatchMessageATranslateMessagePeekMessageAShowWindow^SendMessageASetWindowLongAGetWindowLongAGetCursorPosUpdateWindowUGetParentKReleaseCaptureWindowFromPointEClientToScreenpSetCursorLoadCursorAgSetCaptureCallWindowProcAgCreateWindowExAEnableWindow$GetFocusMessageBeep wvsprintfAMessageBoxAKillTimerzSetForegroundWindowEnableMenuItemnGetSystemMenu\CreateDialogParamAIsWindowEnabledSetWindowPoslGetSysColorLReleaseDCGetDC)PtInRectDefWindowProcA4RegisterClassExA PostQuitMessageTranslateAcceleratorASetWindowTextAFClipCursoroGetSystemMetricsEndPaintBeginPaintSystemParametersInfoALoadIconALoadAcceleratorsAUnregisterClassAGetAncestorJGetMessageAGetAsyncKeyState1GetKeyState=CheckMenuItem}GetWindowDestroyMenuTrackPopupMenueCreatePopupMenuUSER32.dllTextOutAGetTextExtentPoint32AfSetBkModeSetTextColor^SelectObjectRCreateSolidBrush;CreateFontIndirectA:CreateFontAGDI32.dll GetSaveFileNameA GetOpenFileNameAChooseFontACOMDLG32.dllgRegQueryValueExA*RegCloseKeyZRegOpenKeyExA7RegDeleteKeyA2RegCreateKeyExAARegDeleteValueAwRegSetValueExAADVAPI32.dllDragFinishDragQueryFileAShellExecuteExAShellExecuteA-FindExecutableADragAcceptFilesSHGetPathFromIDListAwSHBrowseForFolderASHGetMallocSHFileOperationASHELL32.dll OleUninitializeOleInitializeDoDragDropReleaseStgMediumole32.dllHeapFreeHeapAllocSGetSystemTimeAsFileTimeGetDriveTypeARemoveDirectoryAmCreateDirectoryAHUnhandledExceptionFilterSetUnhandledExceptionFilterHeapReAllocExitThreadGetCurrentThreadIdCreateThreadGetModuleHandleAExitProcesspGetCommandLineA&GetProcessHeap<GetStartupInfoA\GetCPInfoInterlockedIncrementInterlockedDecrementSGetACPGetOEMCPIsValidCodePage>TlsGetValue<TlsAlloc?TlsSetValue=TlsFreeSetLastError7TerminateProcessGetCurrentProcessIsDebuggerPresentHeapDestroyHeapCreateaVirtualFreeDeleteCriticalSectionLeaveCriticalSectionEnterCriticalSection^VirtualAllocSetHandleCountGetFileTypeRtlUnwindGetFullPathNameALCMapStringALCMapStringWHeapSizeInitializeCriticalSectionGetConsoleCPGetConsoleModeKFreeEnvironmentStringsAGetEnvironmentStringsLFreeEnvironmentStringsWGetEnvironmentStringsWYQueryPerformanceCounterjGetTickCount@GetStringTypeACGetStringTypeWGetLocaleInfoASetStdHandleBFlushFileBuffersoGetTimeZoneInformationGetConsoleOutputCPWriteConsoleWSetEndOfFileSCompareStringAVCompareStringWSetEnvironmentVariableA ! 5D5D5D5D* ĜŜƜǜȜɜʜ˜̜͜ΜϜМќҜӜԜ՜֜לQSPVRUT O*v52xZ<%xZ<%<<Xwho@example.comnotepad*.txt*.html*.htm*.cgi*.pl Z@*.bak  ABB B0 B` B BpBBB BBBBBBB@B@BB@BPB`B@BPB`BpBBBB@ BF:CbDIJKLMQReklm_fgڜFdEcN@Dus,C abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZxD`y!@~ڣ @ڣ AϢ[@~QQ^ _j21~DCDDDDD0DD(DDpDDDxD        ! 5A CPR S WY l m pr   )    ؔDD D DDDhDc{#Tw=:zc%C1H(d x@(j^(#~%p&('(+(0,(X- 02p5(^6x78H9(;=\p?(@B&DD,GHIJ.LM0OxPPQ(R(PT0VWx8ZZxh\ ]]` abB8dPeje\ gi lNl8v0rsophLsw>@w FFFTP ( @          ?????( ????     (0` =======================ղղղղղ========ƪƪƪƪƪ=====================================================qwqwqwqwqwqwqwqwqwqwqw====fffffcncncncncnMtMtMtMt==fffff==`````UfUfUfUfUf====ImImImIm==`````==ZZZZZG^G^G^G^G^DfDf==ZZZZZ==T~T~T~T~T~9U9U9U9U9U9U9U9U9U9U9U9U9U?_?_==T~T~T~T~T~===NuNuNuNuNu+L+L+L+L+L+L+L+L+L+L+L+L+L;Y;Y==NuNuNuNuNu=====HlHlHlHlHlDDDDDDDDDDDDD6R6R==HlHlHlHlHl===BcBcBcBcBc<<<<<<<<<<<<<2K2K==BcBcBcBcBcBcBcBcBc======$Eh<"=P.\\\=K)R{R{R{U4R4R4R4R4R4R4R4RU=]8=K)R{R{R{=/G%JoJoJo U!F!F!F!F!F!F!F!F U7T5=G%JoJoJo= B @`@`@`U 9 9 9 9 9 9 9 9U0H2=B @`@`@`@`@`1J@h! 6==>8T8T8TUUUUUUUU3L8=>8T8T8T8T8T8T8TQ$hUUUUUU9.E.E.E t0 t0 t0 t0=.E.E.E9=!9.E.E.E t0 t0.E.E.E9TU 5&9&9&9}}}h==&9&9&9 5== 5&9&9&9}Y!&9&9 5RU 0***. . . . . . . ***N. . 0***}N** 0QU, , ,  V V, PU' u u u u u u u u' u u u u u u u u' u u u u u u u98NU#iiiiiiii#iiiiiiii#iiiiiR%8MULULULULUqKU=JU==IU=GUGU=FUFU=DUDU6 DUDUDUDUDUDUDUDU ?????(  Բ`Uf__`Nu*L*L*LMtNu;Z:Y;Z;Z:Y)?)?(>)?(>#######$##AAAAAAAAAAAAAAAA (00 %   h( @ ?? ( wwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww"""'wwwwpwwxwwwwwwwwwwwwwwwwwwwtwwwwwwDDDGwwwpwwwwwwwwwwwwwwwwwwwwwpwpwpwwwwwwpwwwwppwwwwwwwwpwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww*!wwwpwwwwwwwpwwwwwpwwwwDGwwwwwDDDGwwwwwwwwwwxwxpwpwpwwwwwwwwpwwwpwwp wwp wwwwDDwwwwwwwwwwww""/pwpwppppppwwppwpwpwpwpwppwwww*)wwwwwwwpwwwpwwwwwtDDwwwwwDDDGwwwwwwpwwwpwp"""wwwwwwwwwwwwwwww wwp wwp wwwDDDDwwwpwwwwwww"""wwwwwwwwwwwwwwwwpppppwwwpwpwpwpwwwwww*)ww wwwwwpwwwwpwwwwDDDGwwwwDDDGwwwpwwwwwxpwp"""/wwpwwpwwpwwwwp wwp wwtDGtDGwww wwwwww""pwpwppppwwpwpppwwwpwwwwwwwwww*)w xwwywwwpwwwtDDDDwwwwDDDGwwwwwpwwxpwp"/wwwwwwwwwwwwwwwpwp wwp wwtGwwtGwwwpwwp""/wwwwwwwwwwwwwwwwpwwppppppwwwwwwwwwwwwwpwww*)ww wwwwwwwywwwDDDDDGwwwDDDGwwwwpwwwwpwp"/wwwpwwwwwwwwwwppwp wwp wwDGwwtDwwww wwp""/pwpwppppwwppwwppwwwwwwpw""*""'wwwwyww wwtDDDDDDwDDDDDDDGwwwwwpxwpwp"""wpwwwwwwwwppwp wwp wwDwwwwDwwwwpwwwp""wwwwwwwwwwwwwwwwpwwwwwwpwwwwwwwwwpwpwrwwwwwwwwyww wwDDDDDDDGtDDDDDDwwwwpwwwpwp"""wwwwwwwwwwwwwwwwwwppwww wwp wwwwDwwGwDwwww wwwp"""pwpwppppwwwwwwpwwwwwwwwwpwpww*)wwpwywwwwwwDDDGwwwDDDDDGwwwwwwwxwpwp"/wppwwwwwwppwpp ww wwp pwwDwwDGDwwwpwwwp"/wwwwwwwwwwwwwwwwpwwwwwwwwpwwwwwwwwwpwrwwpwyww wwwwDDDGwwwtDDDDwwwwpwwwwxpwp"/wppwwwwwwppwpwwwpwwwpwwwDGwDDDwwwp wwpwpwpwppppwwwwwwwwpwwwwpwpwpwww*)wwyww wwwwDDDGwwwwDDDGwwwpwpwwwwpwp"""/wppwwwwwwwwppwpw wwwwpwwpwppwwtGwDDGwwwwp wwpwwwwwwwwwwwwwwwwwpwwwwwwwwpwwwwwwwwwpwwpwwwrww xwwppwwpwwwwDDDGwwwwtDDwwwwwwwwwwxwxwpwp"""wpwpwpwwwwpwwwpppwwpwwwwtGwDDDwwwwwp wpwwwpwpwpwwwwwpwwwwwwwpwwpwwww*)w wwwwppwwwpwwwDDDGwwwwwDGwwwwwwwwwwwwwwwwwwpwpwppwwwwwwwwppwwwwwwwwwwwpwwppwwwwwwwDDDwwwwwwpwpwwwwwwwwwwwwwwwwwwwpwwwwwpwwwwpwwpwwpwwwwrqwww wwwwwwppwwwwwwwwDDDGwwwwwtwwwwwwwwwwwwwwwwwwwwwxwpwwpwwppwwwwwwwwppwwwwwwwwwwwwpwwwwwwwwwwwwwwwDDDGwwwwwwppwwwpwpwwpppwwwwwwwwwwwwwwwwwpwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwpwwpwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwpwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwxww( wwwwwwwwwwwwwwwwxxwppww ww  wwwwwwwwwwxwwwwxwwppwwwwwwwwwwpwwwwwwwwwwwwwwpw(P 𙙙xxxxxpxxxxxp𙙐 {{{{{ {{{{{wwwwwwpppwp {{{p{ {{{{{wpppwwwwwwp {{{p{ {{{{{wwwwzpppwwwwzp wwwwwwy   {{ {{ (0 wwwwwxsssssspsssssswwpx0{{{{{{p{{{{{p0{{{{{{p {{{{{ppwwww 00DDG {{{{{{p p G 00 G G {{{{ {{{{   wwwwc}(&F)Cc}(&C)... Ctrl+Cb0000c}(&Q)... Ctrl+QDRe(&R)000n0-[(&H)...-[(&S)xWS_FTPK00-[000000(&W)...-[00000k0OX[(&S)...-[00000K00_CQ(&L)...hQ-[n0mS...AB}N(&X)0000(&C)I000000(&D) Ctrl+DJ000000(&U) Ctrl+U TMR0 YH0f0000000(&O)... TMR0 YH0f0000000(&P)... TMR0c[W0f0000000(&G)...ߜ0000h0W0f0000000(&F)000000000000(&M)... Ctrl+Shift+Uœ0000[ϑ{(&Z)...ޜ000000000000(&L)... Ctrl+Shift+DKJRd(&R)... DelL TMR Yf(&N)... Ctrl+Na^\'` Yf(&A)... Ctrl+TM0000\Ob(&K)... Ctrl+KNan00000(&C)...0000 TBfyR(&S)000000(&B)iR - 000tP(&H)R - 0000tP(&L)R !Ne(&B)j}Ɩ(&E)... Ctrl+Bh:y(&V)0000(&L)... Ctrl+Ysi"}(&F)... Ctrl+Ft!k0i"}(&N) F3qxb(U)... Ctrl+SrhQxbd(&A) Ctrl+Ab__(&T)fN(&L)gs0}(&D)]000(&S)...vg0Y~0000000h:y(&D)0000N00000g0h:y(&I)QtQ[00000g0h:y(&W)_gen0`1Xk0fe(&R) F5000(&T)ݜ0000000000{(&O)...00000(&O)NtX-[(&S)...000(&H)hv!k(&C) F1ٜQ&&AƖ(0000000k0c}W0~0Y0)(T)OFFFTPk0d0D0f0(&A)...dummyE Nx0(remote)F Nx0(local)n Nx0(qQ)GCOMBO_LOCALHCOMBO REMOTEQText ModeRBinary ModeeAuto Mode[Qh:y(local)\Qh:y(remote)cCHDIR(remote)dCHDIR(local)kKANJI EUClKANJI JISmKANJI NONEo0000000JS҉K0j0 YcO0O0O0Üc}juSc[ Ĝ00001Ŝ00002Ɯ00003ǜ00004Ȝ00005ɜ00006ʜ00007˜00008̜00009͜000010Μ000011Ϝ000012М000013ќ000014Ҝ000015Ӝ000016Ԝ000017՜000018֜000019ל000020؜RB}Nڜ-NbkURL00000000x0hQf00000000hQf00000000ȀwFFFTPk0d0D0f0 -3 00000P5b2OKPeP ZFFFTP Ver 1.96dPSFFFTPo0freewareg0Y0PCopyright(C) 1997-2008 SotaP55P( PCOLE D&&D by s^0uJU000nakkaU00[ -3 00000PIJS0n000000-NbkP]I.!kNM-NbkPI*hQf0-NbkP(000P-P(0000P-P,(rlP-,P: msctls_progress32Progress1P(000P-0/Pb'000 YcP80ȀE -3 00000P" P 32OKPD3200000P32 -Nbk(&S)PPn0eW0D0 TMR0eQRW0f0O0`0U0D00Ȁ7 -3 00000P%-o0D0(&Y)P9%,D0D0H0(&N)Pk%-hQf0JRd(&A)P%--Nbk(&S)PP0JRdW0~0Y0K0`̂ x000N -3 000002PYOSysTreeView32Tree1Pf2c}(&S)P[f2X00(&O)P2Qe000(&N)...P2Sexp(&G)...P&2P-[ Yf(&M)...P62V000(&C)PF2RJRd(&D)...PVT!PVU!Pj Pf2 000@H -3 00000P^000n0-[ T(&T)P^ PkI000 T0000 (&N)Pj^ P#<000 T(&U)P-B PO#^00000/000000(&P)PO-@ P/2 an&onymousP?Y0000n0Rg0000(&L)PI PI ...P[^000n0Rg0000(&R)Pe Pe7s(Wn0kPz g_k00000W0_000000!kVn0Rg0000h0Y00(&F)Ȁm#Open -3 00000P\ 0000(&D):SP \DaPh\ C0000(&V):SPr\DqPi2OKPi200000Pi.2&HelpPiD2 &Read OnlyS@fc`@yS BFile &Name:@hS @c AList Files of &Type:C@ks$pP X@@H -3 00000P;0000000(&M)P P$0000000o0anonymous FTPn000000h0W0f0O(uU00~0Y00@H -3 00000P'0000(&1)P P ...P?'0000(&2)PJ PJ ...P]'0000(&3)Ph Ph ...P!0000o0000000000k0#e0Q000f0D0j0D000000 0O0 0g0O0h0M0k00O(uW0~0Y00 ~0_00 00000N`1Xn0s0}h:y 0g00O(uW0~0Y00P|00000o0000S0000000g0O(ug0M0~0Y00Ȁm^\'`n0 Yf -3 00000PMJ/s(Wn0^\'` P|H P0:0000P |TQP# fP2 [LP=0:0000PG |TQPG# fPG1 [LPt0:]0n0NP~ |TQP~$ fP~3 [LPIEZP\0OKP=\000000Pt\0 000Ȁ000 -3 00000PQ0000P JP0000 T(&1) PB 0000 T P*B b5_P[ P7B 000 PDB eNPQB P dJ40000 T(&2) PpB 0000 T P|B eNPB PbR000PfJP0000 T(&3) PkB 0000 T Pk*B b5_P[ Pk7B 000 PkDB eNPkQB PfdJ40000 T(&4) PkpB 0000 T Pk|B eNPkB P y000T0h0k0000n0el0aY00(&S)P 2OKPE200000P2 000Ȁ: -3 00000P P$(2OKPf(200000H( P\ObY000000n0 TMR0eQRW0f0O0`0U0D00@H -3 00000P 00000MOn0OX[Y00(&W)P ,0000N000000Y00!kVwRBfK00 (&L)P%[000000000n0pe(&B) Ps#2P# +msctls_updown32Spin1P'(1^99)P2t .000000OX[Y00(&S)PA00000\Omi00000\ObY000000(&F)PK {PK |...PK }jnP_ -[000000g0j0O0INI0000k0OX[Y00 (&I)Pz( 0000 ]c}HQ -3 00000P000 T0000 ~0_0o0URL(&H)B!PVoP"9000 T(&U)P,P nPc"W00000/000000(&P)Pc,P mP=K FireWall0OF0(&F)PT=S PASV0000OF0(&V)P$K2OKPeK200000+00000/000000 -3 00000P P$2OKPe200000HȀ:000 T -3 00000P PI Anonymous(&A)P$(2OKPe(200000+0000 -3 00000P P$2OKPe200000H@FFFTPn0B}N -3 00000P.200000PL.27_6RB}NP!0000-Ng0Y00 0000L0B}NW0f0K000FFFTP0B}NU0[0f0O0`0U0D00@H -3 00000PE0000 Tn0 Yf P  H0000 T0hQf0\eW[k0W0f0(&L) P  J0000 T0hQf0'YeW[k0W0f0(&U) P * I]0n0~0~0n00000 Tg0(&N)PP000000000000Bf(&T) PZVP!Z Xmsctls_updown32Spin1P-^k0^300y 0=000000j0W0 Pl00000n000000000(&D)Pv 2Pv 4...P8000000000000Bfn0-[o00 0000000 000n0-Nk0B00~0Y00@H -3 00000PB TX0 TMRn00000L0B00BfP 000000Bf P2  NfM0(&O) PP^ x000000h:y(&D)P .000000Bf P80  NfM0(&W) PP8j x000000h:y(&U)PM000n00000000n0R\O PW5 7O0(&P) PPWf 8000000(&L)Pj000Q0000yR_j Pv8 xj0W0(&N) PPv8 xB00(&Y) Pv8 O(uW0j0D0(&K)@̂ m000000 -3 00000PKP[Z2X00(&O)PZ20000(&J)P2 eR(&N)...P2! Yf(&M)...P-2JRd(&D)PA!PA!P` PZ2 000@H -3 00000PZFireWalln0000(&T)!PhpP PFireWall000(&H)P) P $000(&X) P)# P8LFireWall000 T(&U)PAD PY8LFireWall00000(&P)PYAD P7)@n0 Yf(&D)PA# PP?000000(&Q)!PY9KPGS 000n0i"}o0SOCKS000k0N[00(&S)PG` OPEN/SITE00000\eW[k0Y00(&L)Pm 000Nk0*g{v2n0000o0FireWall0Oc0f0c}(&C)Pz 000Nk0*g{v2n0000o0PASV0000OF0(&V)@H -3 00000P\ %FireWall0OF0(&F)P\ PASV0000OF0(&V)P%] 0000 TBfyR0OF0(&S)P86000juS(&X) PB 6PB EjnPWA00000(&C)Pa> bPgQ000n0000000(&T)C!PgGfUPg#H000000(&Q)!Pg-GK~PgAac}Bfk0000k000000(&I)PgL\c*FFFTP000 -3 00000PRS0n000000-NbkPf2hQf0-NbkP 0000L0D0c0q0D0g0Y00Ȁ8 -3 00000P Py ckhs(&R)P$&2OKPe&200000YFFFTP -3 00000P P G2OKPDG200000P{G2 000H=P00000000eQRW0f0O0`0U0D00S0n00000o0anonymous-FTPn000000h0W0f0O(uW0~0Y00P0S0S0g0eQRW0_00000000o00_g000000n0 0000 000n0h0S00g0 Yfg0M0~0Y00@H -3 00000P c}Bfk0Wave000000Y0(&C)Pt 9P =...P% A000P* B}NBfk0Wave000000Y0(&T)P7t :P7 >...P7% B000PK 000n0BfWave000000Y0(&E)PXt ;PX ?...PX% C000AFFFTP000 -3 00000P /LS0n000000-NbkP_/LhQf0-NbkP L0000000g0M0~0[00g0W0_00PzP AFFFTP000 -3 00000P /LS0n000000-NbkP_/LhQf0-NbkP L0000000g0M0~0[00g0W0_00PzP @H -3 00000PbF000n0"oW[000(&K) P Q $!q Yc (SHIFT-JIS) P !) "JIS P -) #EUCP >W JS҉000hQ҉k0 YcPnZg0000 Tn0"oW[000(&N) PrA &SHIFT-JIS Pr!F 'JIS Pr-) (EUC Pr9B )Samba-HEX PrE@ +Samba-CAP PrQ) *UTF-8NPr_Q JS҉000hQ҉k0 Yc@H -3 00000P]8000 P U 8^k00000000(&A) P !T 8^k00000000(&B) P /Q 0000 Tg0RfH0(&X)PhcT0000000n00000 T(&F)Pm5CEPFR(&I)...P&GJRdP^ 0000000g0000000Bf0EOF(Ctrl-Z)0S0dO0(&Z)Pl 000000Y000000n000000000}c(&T)Pb1!Pz 0000 Tn000000NMo0S0dD0f0000000(&S) w000000n0x -3 00000 P&c P NfM0(&O) P2c QeW0Q00p0 NfM0(&T) P>c Q00000 (&R) PJc R000L0 TMR0NQ00(&M) PVc S000000W0j0D0(&N)Pq'g)UF0 TMRg0000000Y00Bfo00 TMR0 YfW0f0 0 NfM0 00bW0f0O0`0U0D00Pe2OKP?e2NNMhQf0(&A)Pve2hQf0-Nbk(&S)Pe) 000P000k0 TX0 TMRn00000L0B00~0Y0P OWhQ-[n0mS -3 00000P)1GD0D0H0P}BmSPx000n0-[0+T00FFFTPOn0hQf0n0-[`1X0mSW0f0B}NW0~0Y00P!-[0mSW0~0Y0K0PE -3 00000P" ZP#32OKPe32[-Nbk(&S)PYPn0 TMR0 YfW0f0O0`0U0D00>00000 -3 00000P P$,2OKPe,200000H2P0000g0M0~0[000 ckW0D0000000eQRW0f0O0`0U0D00200000n0OX[ -3 00000PckW0D0000000000n0-[k0OX[W0~0Y0K0P2o0D0PN2D0D0H0Ȁ jxb0000 -3 00000PmxbY000000(&F)P ]P" ^ckhs(&R)P/ 000n0eL0eW0D00000o0dY(&N)P< 000n0eL0SD00000o0dY(&O)PI _000k0ek0B000000o0dY(&X)P X2OKPDX200000P~X2 000Ȁ jxb000 -3 00000PmxbY000000(&F)P ]P" ^ckhs(&R)P/ 0000n0eL0eW0D00000o0dY(&N)P< 0000n0eL0SD00000o0dY(&O)PI _0000k0ek0B000000o0dY(&X)P X2OKPDX200000P~X2 000 000000000000 -3 00000P3r2QtQ[h:yPr)Y(&S)Phr-00000Pr! 000PLP#B000000000000o0!kn0Qt0LD0~0Y00 %0000tP!000tPx0n0000 %000tPn00000n0JRd QtQ[h:y0bY0h00000JRdY000000n0N0h:yW0~0Y00P0000000000000YW0~0Y00Pfd! N0xW0f0O0`0U0D0P .*00000 -3 00000P P$2OKPe200000H@H -3 00000P_PW0j0D00000 T(&F)P 2?dPBeR(&I)...PB%fJRdPA8!0000 T0c[g0M0~0Y0Pl_PJRdW0j0D00000 T(&R)Pq2?HPIR(&A)...P%JJRdP8!0000 T0c[g0M0~0Y0Pa 0000 T0hQf0\eW[k0W0f0(&L)Po 000000000000g00000JRdMRk0x(&U)P} 000000000000g00000JRdMRk0x(&D)=Nan00000 -3 00000P P +2OKPD+200000P~+2 000P0000n00_h0Y000000o0c[g0M0~0[000H *000000Y000000 -3 00000P P$2OKPe200000H@H -3 00000P wRBfk0c}000000h:yY00(&C)P c}00000g0000n0-[0LF0(&O)P! 00000B}NBfk00000000(RAS)0ReY00(&D)P0 0000000(RAS)Ren0x0LF0(&N)PA[c}000n00000 Ppe(&H) Pc? Pt> !msctls_updown32Spin1PA(0^20)PP c}0000k0000000aY00(&P)P^ 0000c}o0anonymous-FTP0W,gh0Y00(&Q)Pl ReBfk0QUIT000000(&U)Pz RASn06R_0L0j0D0(&R).FFFTP -3 00000P2o0D0PV2D0D0H0P0000000c}0ReW0~0Y0K0ȀL0000[ϑ -3 00000P*72OKPujPukPu000000N Nn00000n0[ϑ0+T0~0Y00ȀF0000[ϑ -3 00000P12OKPR1200000P! xbW0_00000`0Q0{Y00(&S)PP{k0BfL0K0K004XTL0B00~0Y0 @H -3 00000P LIST0000g00000N0S_(&L)P NLST -R 0Oc0f0ؚk0Q0^i"}(&N)P# 0000g0000000000W0j0D0(&F)P3S^\'` Yf0000(&A)P=> CPF= DjnPPE000n0.z^(&H)!PZGKiPmYNLST0000 T/00000Pw> hPFw FjnȀE000 -3 00000P302-NbkP00000000x0yRg0M0j0D0_000QtL0}Lg0M0~0[000PQt0-NbkW0~0Y00@H -3 00000P|_000000Y000000n0^\'`(&P)P NMqSysListView32List1P_rR(&A)...P_&sJRdPm 000000Bfk0\ObY000000n0^\'`0c[Y00(&F)P}^\'` P%{ Ȁ {E00000^\'`n0-[ -3 00000P10000 T(&F)P/ tP:!PG(^\'`(&A) PG Pf x...PH#(O 644)P02OKPB0200000ȀV, -3 00000PH P!OKP.!wl~HG <0000000000 -3 00000P-'2OKP0000000000n000000juSL010N Nk0j00~0W0_00 000000feW0f0O0`0U0D00Ȁ h0000000000n0{ -3 00000P 400000(&C)P=w P4000000(&P)P=w P*400000(&R)P='w P*6000000 P1@4 MD&4, S/KEY Pk@ MD&5 P@$ SHA-&1P S2{PDS2B}NP~S2 000`̂ 000000000000 -3 00000P!kn000000JRdW0~0Y00 PNP2[LP>200000P Pu2 000P``Gx0`0Qt0W0j0D0PsP~P`̂ 000000000000 -3 00000P\!kn0Qt0LD0~0Y00 PNP2[LP>200000P Pu2 000Po`8NK00JRdPsP~P 000000000000 -3 00000PUQtQ[h:yx020(&S)Pa200000P$ 000PNP#@000000000000o0!kn0Qt0LD0~0Y00 %000tP!0000tPx0n0000 %0000tPn00000n0JRd 0000tPn000000JRdY00Qt0+T0~0Y00 T0laO0`0U0D00P0000000000000YW0~0Y00Pi&& 000000g0Y0 &&Py^! N0xW0f0O0`0U0D0P "+0000 -3 00000P P ...P$2OKPe200000O0000 -3 00000P P pen000000c[Y00h0M0o000000g0:SRc0f0O0`0U0D00! *.txt*.log 0000n0-[o00000n0k00q_W0~0Y00P=)OKP3=)hQh:yP_=)00000P=) 000*0000 T -3 00000P P$2OKPe200000H'000n0JRd -3 00000P 2o0D0(&Y)PI2D0D0H0(&N)Px 000n0-[0JRdW0~0Y0K0/0000n0JRd -3 00000P 2o0D0(&Y)PI2D0D0H0(&N)Py0000h00000Qn0hQf0n0000n0-[0JRdW0~0Y0K0`̂ j000N -3 000002PKOSysTreeView32Tree1PX2c}(&S)P`X2X00(&O)P\ HXQe000(&N)...HXSexp(&G)...HXP-[ Yf(&M)...HXV000(&C)HXRJRd(&D)...HXT!HXU!/FFFTP000 -3 00000P-o0D0P8NS0n000000-NbkP-hQf0-NbkPS0n0000o00000000000W0f0D0~0[000 NfM0W0~0Y0K0C000000 -3 00000P P12OKPh12-NbkP000000000 Tk0OH0j0D0eW[L0B00~0Y00 TMR0 YfW0f0O0`0U0D00H7@H -3 00000Pn 0000000g0c}Y00(&D)Pac}Y00q3^0000(&E)!P!eP5 %Rn00000x0c}-Ng00 Nx0c}W0j0J0Y0(&A)PCt c}W0j0J0Y0k0xY00(&N)CFFFTP -3 00000P.2o0D0PL.Bs(Wn0c}0OcPs(Wc}-Nn000000000ReW0f0,00000000n0c}HQ0 YfW0~0Y00P00W0D0g0Y0K0% -3 00000P6200000P] -3 00000P0000000c}n0_00n0000 T0000000eQRW0f0O0`0U0D00P-000 T(&U)P>_P4-00000(&P)P>1_PH2OKP`H200000@H -3 00000P$2 Yf(&F)PP 0000P( {1P W0^\'`n0000000000o0h:yW0j0D0(&H)P,W0^\'`n000000h:yW0j0D00F0k0Y00h00000000000000g00W0^\'`n00000o0000000W0j0D00F0k0j00~0Y00PO 0000tPn00000Nk00000 T0h:yY00(&D)ȀS000000 -3 00000P0000tPn00000 T(&L)P P%000tPn00000(&H)P/ P$A2OKPeA200000 l000000n0x -3 00000 P'c I NfM0(&O) P3c LeW0Q00p0 NfM0(&T) P?c JQ00000 (&R) PKc K000000W0j0D0(&N)Pq(g'UF0 TMRg0000000Y00Bfo00 TMR0 YfW0f0 0 NfM0 00bW0f0O0`0U0D00PZ2OKP?Z2NNMhQf0(&A)PvZ2hQf0-Nbk(&S)PZ) 000P0000tPk0 TX0 TMRn00000L0B00~0Y0P MȀ Transfering -3 00000ȀR000000000n0yR -3 00000P,=2o0D0Pk=2D0D0H0PXxbW0_00000000000P000000P!P0000k0yRW0~0Y0K0P/p000g0o0B00~0[000yRg0Y00 ( @@ -MM- @ @4( @@ xx @?? @4 ( @ `C @4 ( @ C  D @A@B"@DB@H@1@"1C ?> ?<?8